2295 Results for: "peptide synthesis"
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: Fujifilm Irvine Scientific
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: Fujifilm Irvine Scientific
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Bovine;Human;Pig Glucagon (1-29)
Supplier: Anaspec
Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycemia.
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3482.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Ala-Gly-NH2·HCl
Supplier: Chem-Impex International
Ala-Gly-NH2·HCl, also known as L-Alanylglycine hydrochloride, is a dipeptide derivative that plays a significant role in various biochemical applications. This compound is particularly valued in the fields of pharmaceuticals and biochemistry due to its ability to act as a building block for peptide synthesis. Its unique structure allows it to participate in the formation of more complex peptides, making it an essential component in drug development and research. Researchers often utilize Ala-Gly-NH2·HCl in studies related to protein synthesis, enzyme activity, and metabolic pathways, providing insights into cellular functions and therapeutic potentials. In addition to its applications in research, Ala-Gly-NH2·HCl is also explored for its potential benefits in nutritional supplements and functional foods. Its properties may contribute to improved muscle recovery and overall health, appealing to both athletes and health-conscious consumers. The compound’s stability and solubility in aqueous solutions further enhance its usability in various formulations. With its diverse applications and benefits, Ala-Gly-NH2·HCl stands out as a valuable asset for researchers and industry professionals alike.
Expand 1 Items
Prosaptide TX14(A) Peptide
Supplier: Anaspec
This 14-mer prosaptide sequence is derived from the active neurotrophic region in the amino-terminal portion of the saposin C domain. Synthetic peptides derived from this region are biologically active and are named “prosaptides.” Prosaposin and prosaptides are active on a variety of neuronal cells, stimulating sulfatide synthesis and increasing sulfatide concentration in Schwann cells and oligodendrocytes. This indicates that prosaposin and prosaptides are trophic factors for myelin formation.
Sequence:TaLIDNNATEEILY
MW:1579.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Fmoc-β-(3-benzothienyl)-Ala-OH
Supplier: Aladdin Scientific
Fmoc-β-(3-benzothienyl)-Ala-OH is an Fmoc protected alanine derivative that is potentially useful for proteomics studies and solid phase peptide synthesis techniques. Alanine is one of the simplest amino acids - a methyl group as the side chain. This small side chain confers a high degree of flexibility (second only to glycine) when incorporated into a polypeptide chain. The Fmoc group is typically removed with a base such as pyridine - an orthogonal de-protection strategy to the acid labilie Boc group.An Fmoc protected alanine derivative.
Expand 2 Items
Anti-GHRL Chicken Polyclonal Antibody
Supplier: Genetex
Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release from the pituitary. It has an appetite stimulating effect, induces adiposity, and stimulates gastric acid secretion, and it is involved in growth regulation. Ghrelin is synthesized as a preprohormone, then proteolytically processed to yield a 28 amino acid peptide. An interesting and unique modification is imposed on the hormone during synthesis in the form of an n octanoic acid bound to one of its amino acids. This modification is necessary for biologic activity.
Expand 1 Items
Anti-GHRL Mouse Monoclonal Antibody [clone: Ghr5]
Supplier: Genetex
Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release from the pituitary. It has an appetite stimulating effect, induces adiposity, and stimulates gastric acid secretion, and it is involved in growth regulation. Ghrelin is synthesized as a preprohormone, then proteolytically processed to yield a 28 amino acid peptide. An interesting and unique modification is imposed on the hormone during synthesis in the form of an n octanoic acid bound to one of its amino acids. This modification is necessary for biologic activity.
Expand 1 Items
Cycloheximide, white powder cell culture reagent
Supplier: MP Biomedicals
Cycloheximide is a glutarimide antibiotic derived from a microbial source. Cycloheximide is an antibiotic which is very active against many molds, yeasts, and phytopathogenic fungi. It exhibits somewhat lower activity against bacteria and certain fungi. Control of various molds and fungi in gelatin-based photographic emulsions, photoengraving glues, and other light-sensitive products is suggested.
Cycloheximide is used in plant research to study disease resistance and as an ethylene stimulant, useful in studies involving fruit and leaf production. It is also used in bacteriological media to isolate or count bacteria in the presence of yeast and molds; Used in protein synthesis in apoptosis; Gene expression; Glycogenolysis, gluconeogenesis and ureogenesis in isolated rat hepatocytes; Studies involving steroidogenesis; Used in plant regulation and as a quality control measure by the food and beverage industry.
Cycloheximide (CHX) is an antibiotic produced by S. griseus. Its main biological activity is translation inhibition in eukaryotes resulting in cell growth arrest and cell death. CHX is widely used for selection of CHX-resistant strains of yeast and fungi, controlled inhibition of protein synthesis for detection of short-lived proteins and super-induction of protein expression, and apoptosis induction or facilitation of apoptosis induction by death receptors. Cycloheximide inhibits peptide synthesis in eukaryotic organisms but not in prokaryotes. Protein synthesis is blocked by the interaction of cycloheximide with the translocase enzyme. This interaction prohibits the translocation of messenger RNA on the cytosolic, 80S ribosomes without inhibiting organelle protein synthesis. Cycloheximide is also known to induce FAS/FAS Ligand apoptosis, and triggers apoptosis in HL-60 cells, T-cell hybridomas, Burkitt's lymphoma cells in addition to a variety of other cell types. Cycloheximide will also delay or inhibit apoptosis induced by other agents.
Expand 2 Items
Bovine;Human;Pig Biotin-Glucagon (1-29)
Supplier: Anaspec
This is N-terminal biotin labeled Glucagon (1-29). Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3709.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Ophthalmic Acid
Supplier: Chem-Impex International
Ophthalmic Acid is a vital compound recognized for its significant role in biochemical research and pharmaceutical applications. This amino acid derivative, characterized by its unique structure, serves as a crucial building block in the synthesis of various biologically active molecules. Its ability to participate in peptide synthesis makes it particularly valuable in the development of therapeutic agents and research applications in the fields of biochemistry and molecular biology. Researchers utilize Ophthalmic Acid to explore metabolic pathways and enzyme functions, contributing to advancements in drug discovery and development. In addition to its applications in research, Ophthalmic Acid is also gaining attention in the cosmetic industry for its potential benefits in skin health and rejuvenation. Its properties may support the formulation of products aimed at enhancing skin hydration and elasticity. With its diverse applications and ongoing research into its benefits, Ophthalmic Acid stands out as a compound of interest for professionals seeking innovative solutions in both pharmaceutical and cosmetic formulations.
Expand 1 Items
Anti-KL Rabbit Polyclonal Antibody
Supplier: Bioss
May have weak glycosidase activity towards glucuronylated steroids. However, it lacks essential active site Glu residues at positions 239 and 872, suggesting it may be inactive as a glycosidase in vivo. May be involved in the regulation of calcium and phosphorus homeostasis by inhibiting the synthesis of active vitamin D (By similarity). Essential factor for the specific interaction between FGF23 and FGFR1 (By similarity). The Klotho peptide generated by cleavage of the membrane-bound isoform may be an anti-aging circulating hormone which would extend life span by inhibiting insulin/IGF1 signaling.
Expand 1 Items
Anti-SERPINA1 Goat Polyclonal Antibody (Biotin)
Supplier: Rockland Immunochemical
A member of the serpin family, Anti-Alpha-1-Anti-Trypsin inhibits serine proteases. With a moderate affinity for plasmin and thrombin, Anti-Alpha-1-Anti-Trypsin antibody mainly targets elastase. It inhibits trypsin, chymotrypsin and plasminogen activator by inhibiting insulin-induced NO synthesis. It also decreases coagulation time and has proteolytic activity against insulin and plasmin. The short peptide from AAT also targets elastase, but not trypsin. Anti-Alpha-1-Anti-Trypsin is ideal for researchers involved in Metabolism, Cancer, and Cardiovascular research.
Expand 1 Items
Rat Amylin
Supplier: Anaspec
This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.
Sequence: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2
MW: 3200.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Anti-SERPINA1 Goat Polyclonal Antibody (BAC)
Supplier: Rockland Immunochemical
A member of the serpin family, Anti-Alpha-1-Anti-Trypsin inhibits serine proteases. With a moderate affinity for plasmin and thrombin, Anti-Alpha-1-Anti-Trypsin antibody mainly targets elastase. It inhibits trypsin, chymotrypsin and plasminogen activator by inhibiting insulin-induced NO synthesis. It also decreases coagulation time and has proteolytic activity against insulin and plasmin. The short peptide from AAT also targets elastase, but not trypsin. Anti-Alpha-1-Anti-Trypsin is ideal for researchers involved in Metabolism, Cancer, and Cardiovascular research.
Expand 1 Items
Human Recombinant CD74 (from HEK293 Cells)
Supplier: Prosci
Cluster of Differentiation 74 (CD74) is also known as HLA class II histocompatibility antigen gamma chain (HLADG), DHLAG, Ia-GAMMA, invariant chain (Abbreviated Ii). CD74 / HLADG is a polypeptide involved in the formation and transport of MHC class II protein. The cell surface form of the invariant chain is known as CD74. CD74 is upregulated in several cancers and is also expressed by non-immune cells during inflammation. CD74 plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha / beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal / lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. CD74 / DHLAG also serves as cell surface receptor for the cytokine MIF.
Expand 1 Items
Anti-ATP5J Rabbit Polyclonal Antibody
Supplier: Proteintech
ATP5J, also known as coupling factor 6 (CF6), is a soluble integral component of mitochondrial ATP synthase. Mitochondrial ATP synthase is a multi-subunit membrane-bound enzyme that catalyzes the synthesis of ATP by utilizing a proton electrochemical gradient. It consists of three domains, namely the extrinsic and intrinsic membrane domains (F1 and F0, respectively) joined by a stalk.CF6 is one of the subunits in the stalk and an essential component for energy transduction. Recently CF6 has also been reported to play a crucial role in the development of insulin resistance and hypertension. CF6 is first synthesized as an immature form in the cytosol, then transported to the mitochondria by an import signal peptide and becomes an active form with the signal peptide cleaved. Western blot analysis of CF6 demonstrates a single band around 9kD to 12 kD in various tissues including heart, liver, brain and HUVEC (human umbilical vein endothelial cells).
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody [clone: SPM139]
Supplier: Prosci
Recognizes a polypeptide which is identified as Insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 1 Items
Anti-P4HA1 Rabbit Polyclonal Antibody
Supplier: Proteintech
P4HA1(Prolyl 4-hydroxylase subunit alpha-1) is also named as P4HA and belongs to the P4HA family ,which play a central role in collagen synthesis. P4HA1 catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins. The gene encodes a polypeptide of 517 amino acid residues and a signal peptide of 17 amino acids and the full length protein has two glycosylation sites(uniprot). It can exsit as a heteromer, dimer or tetramer(GENATLAS). P4HA1 has 3 isoforms produced by alternative splicing with the molecular weight of 61-63 kDa and 57-59 kDa.
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody [clone: IRDN/805]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody (Biotin) [clone: IRDN/794]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 2 Items
Anti-GALNT6 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.
Expand 1 Items
Gly-Thr-OH
Supplier: Chem-Impex International
Gly-Thr-OH, also known as Glycine-Threonine, is a naturally occurring amino acid derivative that plays a crucial role in various biochemical processes. This compound is particularly valued in the fields of pharmaceuticals and biotechnology due to its ability to enhance protein synthesis and support metabolic functions. Researchers often utilize Gly-Thr-OH in peptide synthesis and as a building block for more complex molecules, making it an essential component in the development of therapeutic agents and nutritional supplements. Its unique structure allows for improved solubility and bioavailability, which is advantageous in formulations aimed at enhancing human health and performance. In addition to its applications in drug development, Gly-Thr-OH is also explored for its potential benefits in cosmetic formulations, where it can contribute to skin hydration and repair. The compound's versatility makes it a valuable asset in both research and industrial settings, providing a reliable option for professionals seeking to innovate in their respective fields. With its favorable properties and wide-ranging applications, Gly-Thr-OH stands out as a key ingredient for those looking to advance their projects in health, nutrition, and beauty.
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody [clone: SPM531]
Supplier: Prosci
Recognizes a polypeptide which is identified as Insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 1 Items
Gly-Pro-OH
Supplier: Chem-Impex International
Gly-Pro-OH, also known as Glycylproline, is a dipeptide composed of glycine and proline, recognized for its unique structural properties and biological significance. This compound is particularly valuable in the fields of biochemistry and pharmaceuticals, where it is utilized as a building block in peptide synthesis and as a potential therapeutic agent. Its ability to enhance collagen synthesis makes it a promising candidate for applications in skin care formulations and wound healing products. Additionally, Gly-Pro-OH has been studied for its role in modulating cellular functions, which could lead to innovative treatments in regenerative medicine. Researchers and industry professionals appreciate Gly-Pro-OH for its stability and compatibility with various formulations, making it an ideal choice for both cosmetic and pharmaceutical applications. Its unique properties allow for improved bioavailability and efficacy in formulations, setting it apart from similar compounds. With ongoing studies highlighting its potential in enhancing skin elasticity and promoting tissue repair, Gly-Pro-OH stands out as a versatile compound with significant implications for health and wellness.
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody [clone: IRDN/794]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 2 Items
Anti-INS Mouse Monoclonal Antibody [clone: IRDN/805]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 2 Items
Anti-INS Mouse Monoclonal Antibody (Biotin) [clone: IRDN/805]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 2 Items
Anti-INS Mouse Monoclonal Antibody [clone: IRDN/805]
Supplier: Prosci
Recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Expand 1 Items
Anti-INS Mouse Monoclonal Antibody [clone: IRDN/794]
Supplier: Biotium
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.