2295 Results for: "peptide synthesis"
Boc-Ala-Ala-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Losartan potassium >98% Angiotensin AT1 receptor antagonist
Supplier: G-Biosciences
Non-peptide angiotensin II receptor antagonist.1,2 Clinically useful antihypertensive agent.3 Inhibits collagen I synthesis.4 Induces SIRT1 expression and activity and reduces hepatic injury in a rat reduced-size orthotopic liver transplantation model.5 Displays neuroprotective effects along with nimesulide against chronic fatigue stress.6 Displays myocardial antifibrotic activity.
Expand 2 Items
Chloromethylated polystyrene 1.2 - 1.4 meq/g, granules
Supplier: Chem-Impex International
Chloromethyl polystyrene and styrene monomers are copolymerized in order to obtain the Merrifield resin. This method avoids the use of carcinogenic chloromethyl methyl ether. This resin is used in the synthesis of peptide acids using Boc strategy and can be cleaved using HF or TFMSA. Different Boc protected amino acids attached to this resin are also available from stock. Please inquire.
Expand 3 Items
Boc-Ala-Ala-Pro-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Boc-Val-Val-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 1 Items
Anti-TH Rabbit Polyclonal Antibody
Supplier: Prosci
Tyrosine Hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines Dopamine and Norepinephrine. TH antibodies can therefore be used as markers for dopaminergic and noradrenergic neurons. We raised this polyclonal antibody against a peptide representing the sequence around Ser19 in rat TH purified. This antibody is suitable for most immunochemical applications in a variety of mammalian and some non-mammalian species.
Expand 1 Items
Boc-Gly-Gly-Gly-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Chloromethylated polystyrene 0.3 - 0.8 meq/g, granules
Supplier: Chem-Impex International
Chloromethyl polystyrene and styrene monomers are copolymerized in order to obtain the Merrifield resin. This method avoids the use of carcinogenic chloromethyl methyl ether. This resin is used in the synthesis of peptide acids using Boc strategy and can be cleaved using HF or TFMSA. Different Boc protected amino acids attached to this resin are also available from stock. Please inquire.
Expand 3 Items
(2S,4S)-Boc-4-amino-1-Fmoc-pyrrolidine-2-carboxylic acid ≥98% (HPLC)
Supplier: Chem-Impex International
Discover (2S,4S)-Boc-4-amino-1-Fmoc-pyrrolidine-2-carboxylic acid, a key compound in peptide synthesis and drug development. This versatile building block features Boc and Fmoc protecting groups, enhancing its application in creating enantiomerically pure compounds. Ideal for researchers and industry professionals, it streamlines synthetic processes and supports the production of biologically active molecules.
Expand 3 Items
Boc-Phe-Phe-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 1 Items
PR39 propeptide
Supplier: Enzo Life Sciences
A proline-arginine-rich peptide antibiotic. PR39 inhibits DNA and protein synthesis and the degradation of HIF-1alpha. It has been reported to bind to the alpha7 subunit of the 26S proteasome, blocking degradation of the NK-κB inhibitor, IκBα by the ubiquitin-proteasome pathway without affecting overall proteasome activity. More recent studies have demonstrated it to be an efficient inhibitor of all activities of the 20S proteasome.
Expand 1 Items
Boc-Gly-Gly-Phe-Gly-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Azido PEG acid ≥95%
Supplier: Aladdin Scientific
Heterobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via amino or other acid reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.application:Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.
Expand 2 Items
Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)
Supplier: Anaspec
This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Anti-CRHBP Rabbit Polyclonal Antibody (Alexa Fluor® 680)
Supplier: Bioss
CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
Expand 1 Items
Human Recombinant Calcitonin gene-related peptide 2 (from E. coli)
Supplier: Prosci
CALCB is a member of the calcitonin family. CALCB is produced in both peripheral and central neurons. It is a potent peptide vasodilator and can function in the transmission of pain. In the spinal cord, the function and expression of CGRP may differ depending on the location of synthesis. CALCB is derived mainly from the cell bodies of motor neurons when synthesized in the ventral horn of the spinal cord and may contribute to the regeneration of nervous tissue after injury.
Expand 1 Items
Mouse Mgp100 (25-33)
Supplier: Anaspec
This peptide sequence is found in residues 25 to 33 of the mouse self/tumor antigen glycoprotein (mgp100). This fragment is a H-2Db–restricted epitope recognized by CD8+ T cells. Mgp100 is an enzyme normally involved in pigment synthesis, and the epitope fragment is typically expressed in both normal melanocytes and melanoma cells.
Sequence:EGSRNQDWL
MW:1104.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Anti-FDX1 Rabbit Polyclonal Antibody
Supplier: Proteintech
FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acid.
Expand 1 Items
Anti-CRHBP Rabbit Polyclonal Antibody (Alexa Fluor® 750)
Supplier: Bioss
CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
Expand 1 Items
Amino-PEG4-acid ≥98%
Supplier: Aladdin Scientific
Amino-dPEG4-acid has a primary amine and propionic acid terminating opposite ends of a 16-atoms long (18.0 Å) polyethylene glycol (PEG) spacer. The single molecular weight PEG spacer is discrete (Ð = 1). Moreover, it is highly hydrophilic, and it imparts hydrophilicity to conjugates that incorporate it. Amino-dPEG4-acid is useful in many different applications, including peptide synthesis, surface modification, dendrimer construction, and small molecule modification
Expand 4 Items
(D-2-Nal⁶)-LHRH Acetate
Supplier: Bachem Americas
LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).
Expand 2 Items
Anti-NAA10 Rabbit Polyclonal Antibody
Supplier: Prosci
N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides.N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).
Expand 1 Items
Anti-ACSS3 Rabbit Polyclonal Antibody
Supplier: Proteintech
ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids.
Expand 1 Items
cis-4-Aminocyclohexanecarboxylic Acid
Supplier: Aladdin Scientific
cis-4-aminocyclohexanecarboxylic acid (C4-ACHC, cis-ACCA) exists in zwitterionic form. Cyclohexane ring in the molecule of cis-4-aminocyclohexanecarboxylic acid is present in chair conformation. The carboxylate and ammonium groups in the molecule occupy axial and equatorial positions, respectively. It co-crystallizes with water molecules in a 2:1 (amino acid:water ratio). H-Cys-Leu-Gly-Gly-Leu-Leu-Thr-Met-Val-OH (CLG) peptide analogue containing cis-ACCA has been prepared and its activity has been studied. cis-4-Aminocyclohexanecarboxylic acid may be used in the synthesis of new analogs of arginine Vasotocin (AVP). It may be used in the synthesis of cis-4-[[[(2-chloroethyl)nitrosoamino]carbonyl]methylamino]cyclohexanecarboxylic acid.
Expand 3 Items
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: Fujifilm Irvine Scientific
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: Fujifilm Irvine Scientific
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Ser-Gly-Gly-OH
Supplier: Chem-Impex International
Researchers utilize Ser-Gly-Gly-OH in the development of pharmaceuticals and therapeutic agents, particularly in studies focused on neurodegenerative diseases and metabolic disorders. Its properties enable it to act as a stabilizing agent in protein formulations, enhancing the efficacy and stability of biologically active compounds. Additionally, its role in peptide synthesis makes it a valuable tool for scientists exploring peptide-based drug design. With its diverse applications and significant benefits, Ser-Gly-Gly-OH is an indispensable resource for professionals in the life sciences.
Expand 1 Items
Human/Mouse Recombinant TGF-β 3 (Animal free) (from E. coli)
Supplier: Fujifilm Irvine Scientific
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.