117 Results for: "matrix modifier"
Magnesium nitrate solution 20 g/L in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Magnesium nitrate solution 20 g/L in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Magnesium nitrate solution 10000 ppm in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Magnesium nitrate solution 10000 ppm in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Nickel (II) nitrate 10000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Nickel (II) nitrate 10000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Ammonium dihydrogen phosphate 100,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Ammonium dihydrogen phosphate 100,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Palladium(II) nitrate 5000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Palladium(II) nitrate 5000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Ammonium dihydrogen phosphate 20,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Supplier: Ricca Chemical
Ammonium dihydrogen phosphate 20,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy
Expand 1 Items
Nickel (II) nitrate 1% Ni(NO3)2 in nitric acid 2%, Specpure®
Supplier: Thermo Scientific Chemicals
Matrix Modifier Solution
Expand 1 Items
Thiol-Modified Hyaluronan Hydrogel Kit, HyStem®, Advanced BioMatrix
Supplier: Advanced Biomatrix
HyStem® Hydrogel Kit - The growth factor delivery matrix
Expand 3 Items
HiTrap Columns, Capto Q ImpRes, Cytiva
Supplier: Cytiva
Capto Q ImpRes has a strong quarternary anion exchanger coupled to a chemically modified, high-flow agarose matrix.
Expand 2 Items
Anti-ST6GALNAC5 Rabbit Polyclonal Antibody
Supplier: Prosci
ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).
Expand 1 Items
Anti-ST6 (alpha-N-acetyl-neuraminyl-2 3-beta-galactosyl-1 3)-N-acetylgalactosaminide alpha-2 6-sialyltransferase 6 Rabbit Polyclonal Antibody
Supplier: Prosci
ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).
Expand 1 Items
IMAC Sepharose™ 6 Fast Flow Affinity Chromatography Media, Cytiva
Supplier: Cytiva
IMAC Sepharose 6 Fast Flow is composed of cross-linked 6% agarose beads modified with a novel chelating ligand immobilized to the base matrix.
Expand 1 Items
Anti-DPT Rabbit Polyclonal Antibody
Supplier: Prosci
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq].
Expand 1 Items
Chelating Sepharose™ Fast Flow Affinity Chromatography Media, Cytiva
Supplier: Cytiva
Chelating Sepharose Fast Flow is composed of cross-linked 6% agarose beads modified with iminodiacetic immobilized to the base matrix by stable ether linkages and sufficiently long spacer arms.
Expand 1 Items
Thiol-Modified Hyaluronan/Heparin Mixture, Heprasil®
Supplier: Advanced Biomatrix
Heprasil® is a mixture of thiol-modified hyaluronic acid thiol-modified heparin. Heprasil® is a component of the HyStem®-HP kits, but can be purchased separately here.
Expand 1 Items
SOURCE™ 30S Ion Exchange Chromatography Media, Cytiva
Supplier: Cytiva
SOURCE 30S is a synthetic high performance, preparative, chromatography medium, based on a 30 µm monosized, rigid polystyrene/divinyl benzene polymer matrix It is modified with sulphonate (S) strong cation exchange groups.
Expand 1 Items
Anti-LONP1 Rabbit Polyclonal Antibody
Supplier: Proteintech
LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.
Expand 1 Items
Anti-LONP1 Mouse Monoclonal Antibody [clone: 1C6C12]
Supplier: Proteintech
LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.
Expand 1 Items
Anti-SATB1 Rabbit Polyclonal Antibody
Supplier: Proteintech
Epigenetic modifications and dynamic changes in chromatin organization by organizer proteins have recently been shown to play an instrumental role in regulating cancer-promoting genes. Special AT-rich binding protein (SATB1) is a unique type of global regulator that integrates higher-order chromatin organization -withregulation of gene expression. SATB1 is a T cell-enriched transcription factor and a chromatin organizer essential for controlling genes that participate in T-cell development and activation. It regulates gene expression by periodically anchoring matrix attachment regions to the nuclear matrix and directly recruiting chromatin-modifying factors. Depending on its posttranslational modifications, SATB1 activates or represses multiple genes.Its expression is regulated by interleukin-4 (IL4) during T helper-2(Th2) cell differentiation.
Expand 1 Items
Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Supplier: Anaspec
This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Anti-CD44 Rabbit Polyclonal Antibody
Supplier: Rockland Immunochemical
CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.
Expand 1 Items
Anti-CD44 Rabbit Polyclonal Antibody
Supplier: Rockland Immunochemical
CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.
Expand 1 Items
Protein Purification Resins, GenScript®
Supplier: Genscript
GenScript offers recombinant protein A with non-essential domains removed, recombinant protein G with albumin binding site deleted as well as codon optimized protein L. By pre-coupling these genetically modified proteins to 4% highly cross-linked agarose, GenScrtipt developed excellent antibody affinity chromatography matrix - Protein A, G and L Resins for batch/gravity purification of polyclonal and monoclonal antibody from cell culture supernatants, serum, and ascites at both laboratory and larger scale. Besides, GenScript provides several affinity resins for convenient and reliable purification of tagged proteins, including His-tagged protein purification resin, GST fusion protein purification resin, DYKDDDDK tagged protein purification resin and Streptavidin resin.
Expand 46 Items
Dextran, M.W. 60,000-90,000 clinical grade
Supplier: MP Biomedicals
Use of dextrans as long and hydrophilic spacer arms improves the performance of immobilized proteins acting on macromolecules. Dextrans are used in many applications as platelet aggregants, plasma volume extenders, osmotic pressure regulators, stabilizers, organ separation media, matrix components, copolymers, microcarriers, binding agents, viscosity modifiers, antithrombotics, lubricants and physical structure components. They may be used as long hydrophilic spacer arms to improve the performance (freedom of movement) of conjugated/bound proteins. Dextrans may be derivatized for use in biosensor systems.
Dextran is branched polysaccharide made up of linear α (1→6) linked glucose units and α (1→3) link initiated branches; it ranges in size from 10,000 to 150,000 Kd.Depending upon its molecular weight it has different uses in different fields.
Physical Appearance: White powder
Solubility: Very soluble in water (50 mg/mL), slightly soluble in alcohol
Expand 5 Items
Anti-CTSK Rabbit Polyclonal Antibody
Supplier: Proteintech
CTSK(cathepsin K), also named as CTSO, CTSO2, is a recently identified lysosomal cysteine proteinase. CTSK is synthesized as a proenzyme of 38 kDa and subsequently enters acidic lysosomal compartments, in which the propeptide is cleaved and transformed into an active enzyme and it may influence adipocyte differentiation through modifying extracellular matrix components. It is revealed both the 46-kDa cathepsin-K precursor and the 30-kDa mature form in mouse bone extracts. The high CTSK protein levels are only detected in primary cultured fibroblasts derived from normal and neoplastic breast tissue, where the 37- and 25-kDa bands to be detected correspond to pro- and mature proteins through western blot. The full length protein has a signal peptides with 15 amino acids and a propeptide with 99 amino acids. CTSK may have cross reaction with the other members of cathepsin family and form a complex of 70 kDa with an unidentified subunit.
Expand 1 Items
MODIFIER-NH4H2PO4 MATRIX 100ML
Supplier: PerkinElmer
MODIFIER-NH4H2PO4 MATRIX 100ML
Expand 1 Items
Thiol-Modified Hyaluronan, Gelatin and Heparin Hydrogel Kit, HyStem®-HP, Advanced BioMatrix
Supplier: Advanced Biomatrix
HyStem®-HP Hydrogel Kit - The growth factor delivery matrix
Expand 3 Items
Thiol-Modified Hyaluronan and Gelatin Hydrogel Kit, HyStem®-C, Advanced BioMatrix
Supplier: Advanced Biomatrix
HyStem®-C Hydrogel Kits - The starter matrix.
Expand 3 Items
CELLvo™ Healthy Human Chondrocytes P0 (50-70y), StemBioSys
Supplier: StemBioSys
CELLvo™ Healthy Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Healthy status is determined by macroscopic inspection of the tissue using a modified outerbridge (1960) scale in order to distinguish healthy joints from those with signs of osteoarthritis. Cells are isolated by enzymatic digestion prior to cryopreservation.
Expand 8 Items
CELLvo™ Osteoarthritic Human Chondrocytes P0 (50-70y), StemBioSys
Supplier: StemBioSys
CELLvo™ Ostoeoarthritic Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Osteoarthritis status is determined by macroscopic inspection using a modified Outerbridge (1960) scale. Cells are isolated by enzymatic digestion prior to cryopreservation.