30267 Results for: "agarose+powder"

Supplier: Thermo Scientific Chemicals

MDL: MFCD00149621 Slightly soluble in water. Soluble in dilute hydrochloric, nitric, and acetic acid. Insoluble in alcohol

Supplier: Brady Worldwide

B-461: Self-laminating polyester is a clear film with a matte white printable zone ideal for cables, laboratory ID or general labeling where graphics need to be protected.
B-490: Durable polyester markers are designed for use in laboratory identification applications such as vials, centrifuge, tubes, test tubes, straws and slides.

Supplier: Ansell Healthcare

HyFlex® 11-591 industrial gloves provide enhanced comfort, with a 20% lighter design that allows extended use on varied tasks.

Supplier: Eagle Manufacturing

Made specifically for small containers up to 18.9 L (5 gal.), these cabinets safely store flammable and nonflammable acids and corrosive liquids.

Supplier: Cloud-Clone

Polyclonal Antibody to Meropenem (Mer), derived from OVA conjugated Mer, is reactive with General species.

Supplier: Ward's Science

Simulate the effects of soil compaction on plant growth in different soil types.

Supplier: Horizon Scientific

These Premier Series pharmacy refrigerators are designed to be built into counters for optimal storage space.

Supplier: Antyila Scientific

Optimized airflow provides even heat transfer for high temperature uniformity.

Supplier: Invitrogen

Purified (unconjugated) Thermo Scientific Pierce Recombinant Protein A is useful as the basis for preparing various kinds of probes or affinity media for detection or purification of rabbit and human antibodies, especially IgG isotypes, in immunoassays and antibody purification protocols.

Supplier: MP Biomedicals

Ham's F-10 Culture Media with L-glutamine and without sodium bicarbonate.

Supplier: Justrite

These Gas Cylinder Mobile Stands with Locking Post provide safety when moving and storing of gas cylinders.

Supplier: Anaspec

This is a reverse transcriptase (RT) epitope (Pol residues 476-484). Within HIV-1 RT the peptide appears to be the dominant HLA A*0201-restricted epitope. Was used to investigate possible mechanisms behind HIV-1 escape from CTL. IV9 is the actual epitope processed and presented in HIV-1-infected cell lines
Sequence:ILKEPVHGV
MW:991.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Ansell Healthcare

Economical solution for medium-duty applications requiring very high cut resistance, grip, and oil-repelling performance in oily environments.

Supplier: Justrite

This Gas Cylinder Process Stand provides safety when moving and storing of gas cylinders.

Supplier: Globe Scientific

Diamond® RealSeal™ Plastic Laboratory Bottles from Globe Scientific meet the requirements of the most demanding applications. Rugged and durable, these bottles are a safe, shatterproof alternative to glass bottles for collection, storage, or shipping samples, media, and reagents.

Supplier: Globe Scientific

Diamond® RealSeal™ Plastic Laboratory Bottles from Globe Scientific meet the requirements of the most demanding applications. Rugged and durable, these bottles are a safe, shatterproof alternative to glass bottles for collection, storage, or shipping samples, media, and reagents.

Supplier: Labconco

Intelli-Sense™ Multi-Speed Fiberglass Blowers are ideal for fume hood exhaust systems in moderate to highly corrosive conditions

Supplier: National Public Seating

Our sit/stand student's desk allows for better blood flow and increased positive posture.

Supplier: Selleck Chemicals

Alisertib (MLN8237) is a selective aurora A inhibitor with IC50 of 1.2 nM in a cell-free assay

Supplier: Tripp Lite

Medical-grade power strips designed and manufactured in accordance with Article 517 and certified to meet UL standards.

Supplier: Biotium

DAPI (4′,6-Diamidino-2-Phenylindole) is a popular blue DNA dye that is used as a nuclear counterstain in fluorescence microscopy, chromosome staining and flow cytometry. The dye binds to the minor groove of dsDNA with approximately 20-fold fluorescence enhancement, with higher affinity for A-T rich regions.

Supplier: Corning

This product is a mix of the antibiotics Penicillin (5,000 IU) and Streptomycin (5,000 μg/ mL) in a 50-fold working concentration. Penicillin (Penicillin G) works by inhibiting peptidoglycan synthesis, while Streptomycin inhibits protein synthesis. Penicillin-Streptomycin is effective against Gram-negative and Gram-positive bacteria. This antibiotic is recommended for use in cell culture media at 20 ml/L.

Supplier: Avantor Fluid Handling

Place where convenient—ideal for limited spaces, hoods, or isolation chambers.

Supplier: Anaspec

Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: PIP

Designed and developed as a breathable glove, MaxiFlex® Ultimate™ has become the benchmark for precision handling in dry environments.

Supplier: LGC Standards

TRC Penicillin V Potassium Salt

Supplier: Magid Glove

The Magid® D-ROC® DXPG59F 18-gauge double-dipped foam nitrile fully coated work gloves features DX+ Technology®, pairing high cut protection with the flexible comfort of a coreless shell.

Supplier: Brady Worldwide

Universal Granular Absorbent is a loose, multi-purpose absorbent ideal for liquid spill clean-up, lab packing, and stabilization of free liquids. Highly versatile absorbents pick up water-based, petroleum-based, and non-aggressive chemical fluids. Corn Cob Granular is perfect for aircraft maintenance, machine shops, food processing, filling lines, and bulk liquid transfer stations. Not for use with aggressive fluids.

Supplier: Cytiva

Thrombin is a protease used to digest fusion proteins prepared from pGEX vectors containing the recognition sequence for thrombin (pGEX-1lT, pGEX-2T, pGEX-2TK, pGEX-4T-1, pGEX-4T-2, and pGEX-4T-3).

Supplier: Thermo Fisher Scientific

Precision general-purpose baths are rugged, high-performance baths ideal for a wide range of lab applications. Capacities range from 2 to 28 l, including shallow and dual-chamber models.