30267 Results for: "agarose+powder"

Supplier: Labconco

Logic Cart fits under any telescoping base stand. Features three small and one large compartments, one drawer, front panel cut out for dispensing wipers or gloves, and HDPE worksurface. W×D×H: 635×483×686 mm (25×19×27").

Supplier: Ansell Healthcare

Ultra-thin ANSI Cut level A5 / ISO Cut level E gloves with 4× more cut resistance for unmatched protection.

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Magid Glove

Magid® D-ROC® GPD883 18-gauge work gloves features AeroDex® for the lightest cut resistance on the market and a VersaTek Grip™ palm coating for extreme durability, dexterity, and grip in any environment.

Supplier: National Public Seating

A high-quality melody music stand meet MAS standards and are a great value.

Supplier: Justrite

These single cylinder hand trucks provides safety when moving and storing of gas cylinders.

Supplier: Anaspec

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Ansell Healthcare

Advanced chemical protection with a great level of cut defense.

Supplier: Anaspec

This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: National Public Seating

The comfortable, institutional-grade 1200 Series premium upholstered folding chair is made with the combination of durable vinyl wrapped over 1¼" of soft foam on our most popular frame.

Supplier: Cytiva

HyClone VaccineXpress cell culture medium is designed and developed for high‑density growth and maintenance of kidney‑derived cell lines (e.g., Vero cells) for viral vaccine development. VaccineXpress medium is well suited for use in multi-well plates and large‑scale manufacturing using microcarriers in WAVE Bioreactor or Xcellerex bioreactors.

Supplier: Anaspec

Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: PIP

Designed and developed as a breathable glove, MaxiFlex® Ultimate™ has become the benchmark for precision handling in dry environments.

Supplier: Cytiva

Thrombin is a protease used to digest fusion proteins prepared from pGEX vectors containing the recognition sequence for thrombin (pGEX-1lT, pGEX-2T, pGEX-2TK, pGEX-4T-1, pGEX-4T-2, and pGEX-4T-3).

Supplier: Thermo Fisher Scientific

Precision general-purpose baths are rugged, high-performance baths ideal for a wide range of lab applications. Capacities range from 2 to 28 l, including shallow and dual-chamber models.

Supplier: Thermo Scientific Chemicals

In photography, analytical lab reagent for phosphate, lead, arsenate determination

Supplier: Magid Glove

The Magid® D-ROC® DXPG59F 18-gauge double-dipped foam nitrile fully coated work gloves features DX+ Technology®, pairing high cut protection with the flexible comfort of a coreless shell.

Supplier: Brady Worldwide

Universal Granular Absorbent is a loose, multi-purpose absorbent ideal for liquid spill clean-up, lab packing, and stabilization of free liquids. Highly versatile absorbents pick up water-based, petroleum-based, and non-aggressive chemical fluids. Corn Cob Granular is perfect for aircraft maintenance, machine shops, food processing, filling lines, and bulk liquid transfer stations. Not for use with aggressive fluids.

Supplier: Antyila Scientific

Replace mercury manometers to elevate precision in vacuum measurements with portable or continuous-display absolute reference gauges.

Supplier: LGC Standards

TRC Penicillin V Potassium Salt

Supplier: MONASHEE MANUFACTURING

A six-foot wide dust hood complete with discharge chute. Slagging hoods effectively capture and collect dust while providing uniform airflow, a clean work surface and protecting the operator from contaminants. These slagging hoods have a convenient steel post with a steel pad to hammer your lead buttons to remove the slag. There is also a chute where the slag is deposited for disposal. Designed for industrial and mining applications, our slagging hoods have a 10” flange for connecting to existing duct work and are required to be connected to an appropriately sized dust collector (sold separately, contact us for more information).

Supplier: Anaspec

This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Horizon Scientific

These Premier Series pharmacy freezers are designed to be built into counters for optimal storage space.

Supplier: Ansell Healthcare

Certified impact protection for heavy-duty jobs with high cut risk.

Supplier: Avantor

BioClean™ sterile cut-resistant glove liners feature Dyneema® Diamond yarn and provide cut resistance and protection during rigorous procedures.

Supplier: MP Biomedicals

Poly-L-lysine is a positively charged amino acid polymer. Poly-lysine binds to DNA, red cell membrane and any negatively charged protein. It is typically used as a coating substrate for culture dishes, slides, etc. It enhances electrostatic interaction between negatively charged ions of the cell membrane and the culture surface. When adsorbed to the culture surface, poly-lysine increases the number of positively charged sites available for cell binding.

Supplier: Cloud-Clone

Polyclonal Antibody to Deoxycholate (DC), derived from BSA conjugated DC, is reactive with General species.

Supplier: Brady Worldwide

Thermal transfer printable, glossy permanent polyester (B-422) labels are ideal for use in all commercial and industrial applications.

Supplier: Horizon Scientific

These Premier Series pharmacy refrigerators are designed to be built into counters for optimal storage space.

Supplier: Justrite

These Gas Cylinder Mobile Stands with Locking Post provide safety when moving and storing of gas cylinders.