30266 Results for: "agarose+powder"

Supplier: Ansell Healthcare

INTERCEPT™ technology ANSI cut level 4 performance for the ultimate in cut resistance.

Supplier: Sheldon Manufacturing

SHEL LAB High Performance Ovens are engineered to meet the most critical temperature requirements

Supplier: Magid Glove

Made from a standard weight cotton and polyester blend, the magid Greyt shadow guard GT955R/GT955RM loops-in terrycloth machine knit glove offers good thermal protection and strong cut and abrasion resistance with form-fitting comfort.

Supplier: LGC Standards

TRC Basic Green 4 (Technical Grade)

Supplier: Lucigen

Dependable, consistent high-fidelity PCR results with every target DNA template, every time

Supplier: BURKLE INC

Designed for sampling according to FDA guidelines for Unit-Dose-Sampling. It is now possible to withdraw a double- or triple-sample without inserting the lance repeatedly into the bulk material. Mixing is mainly prevented in this way.

Supplier: Ansell Healthcare

The TouchNTuff® 73-500 neoprene gloves deliver superior sensitivity and comfort in sterile, aseptic environments.

Supplier: MP Biomedicals

Rich medium for the growth of E. coli and certified for plasmid and other bacterial cultures in liquid medium.

Supplier: HexArmor

The PointGuard® Ultra 4041 is the only mechanic’s style glove to have both cut and needle-resistance, giving end users superior protection, a performance advantage to keep them safer on the job. Designed with specialized silicone gripping surface on palm.

Supplier: Horizon Scientific

These White Diamond Combo Units offer a cold-storage solution for medical and scientific purposes.

Supplier: WISEBATCH LLC MS

The WiseBatch Fentanyl test strip has the ability to test for Fentanyl and several analogues, including but not limited to: acetyl fentanyl, butryl fentanyl, furanyl fentanyl, acryl fentanyl, cyclopropyl fentanyl, 2-fluoro fentanyl, 3-fluoro fentanyl, and 4-fluoro fentanyl. The test strip includes a micro scoop, simple instructions for use, as well as a scannable QR code that leads you to the resources section on our site where you can find a broad spectrum of testing education.

Supplier: Invitrogen

Thermo Scientific Pierce CN/DAB Substrate Kit includes substrate and peroxide solutions for combined chloronaphthol- and diaminobenzidine-based detection of horseradish peroxidase (HRP) activity in Western blot and tissue staining methods.

Supplier: National Public Seating

High-quality height adjustable heavy duty folding table is of a great value.

Supplier: Cytiva

ActiSM™ cell culture media is a chemically defined animal-derived component-free (ADCF) cultured media optimized for high-yield protein production for bioprocessing. This HyClone™ medium is designed for use with ActiPro™ cell culture media.

Supplier: Thermo Scientific Chemicals

MDL: MFCD00150033 Beilstein Registry No.: 3752576 Soluble in water

Supplier: Magid Glove

The Magid® D-ROC® GPD683 18-gauge Work Glove features AeroDex® for the lightest cut resistance on the market and a VersaTek Grip™ palm coating for extreme durability, dexterity, and grip in any environment.

Supplier: Ansell Healthcare

Unique knitted design allows the glove to easily tear at multiple high risk areas, significantly reducing the risk of hand injury if the glove becomes entangled in a rotating tool.

Supplier: Labconco

Popular models of Protector® Premier® Laboratory Hoods and supporting matching work surfaces (sold separately) are available from VWR® stock for immediate shipment

Supplier: Invitrogen

Thermo Scientific HisProbe-HRP is a nickel (Ni²⁺)-activated derivative of horseradish peroxidase (HRP) that enables direct, IMAC-based detection of His-tagged proteins and other histidine-rich proteins in Western blots and microplates.

Supplier: National Public Seating

The comfortable, institutional-grade 1200 Series premium upholstered folding chair is made with the combination of durable vinyl wrapped over 1¼" of soft foam on our most popular frame.

Supplier: FUJIFILM IRVINE SCIENTIFIC INC.

BalanCD CHO Growth A is a chemically-defined, animal component-free growth medium designed to increase process yields of antibodies and recombinant proteins in Chinese Hamster Ovary (CHO) cells. This formulation was developed using FUJIFILM Irvine Scientific’s rational culture media design strategy to achieve enhanced performance of growth and production in batch cultures.

Supplier: Labconco

Intelli-Sense™ Multi-Speed PVC Blowers handle extremely corrosive atmospheres produced by high order oxidizers such as perchloric acid

Supplier: MP Biomedicals

2XYT-Broth is a nutritional rich medium providing nitrogen and growth factors optimized for the growth of recombinant E. coli strains infected with the M13 bacteriophage or other filamentous single stranded DNA bacteriophages thus allowing the bacteriophage to reproduce in large quantities without exhausting the host cells.

Supplier: Anaspec

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: MP Biomedicals

β-NAD is one of the biologically active forms of nicotinic acid. It occurs in living cells primarily in the oxidized state. Serves as a coenzyme of the dehydrogenases, especially in the dehydrogenation of primary and secondary alcohols. NAD usually acts as a hydrogen acceptor, forming NADH which then serves as a hydrogen donor in the respiratory chain.

Supplier: Anaspec

Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: MilliporeSigma

The Overnight Express™ Autoinduction Systems enable regulated protein expression in E. coli, without monitoring the culture or adding inducer during cell growth.

Supplier: Justrite

These Gas Cylinder Barricade Racks provide safety when moving and storing of gas cylinders.

Supplier: Anaspec

Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: PIP

Designed and developed as a breathable glove, MaxiFlex® Ultimate™ has become the benchmark for precision handling in dry environments.