30267 Results for: "agarose+powder"

Supplier: Thermo Scientific Chemicals

MDL: MFCD00036973

Supplier: LGC Standards

TRC Gentian Violet (~90%)

Supplier: Horizon Scientific

These laboratory and pharmaceutical refrigerators offer premium protection for vaccine storage.

Supplier: Kewaunee

Two bay storage system to maximize storage capacity with divided trays, baskets and shelves.

Supplier: Horizon Scientific

These compact pharmacy and vaccine refrigerators provide quality cold storage in limited-space settings.

Supplier: Labconco

The AtmoSense™ Oxygen monitor is designed for general purpose trace oxygen detection as low as 1 ppm.

Supplier: Ansell Healthcare

Electrical insulating gloves are made from natural rubber latex using a proprietary environmentally friendly dipping process for ultimate flexibility and dexterity.

Supplier: Cube Biotech

SMALP BZs are synthesized via RAFT polymerization, achieving a better-defined polymer size and a low dispersity.

Supplier: Justrite

These Gas Cylinder Forklift Pallets with Firewall provide safety when moving and storing of gas cylinders.

Supplier: Invitrogen

Thermo Scientific Pierce Protein A to probe and detect rabbit and human antibodies, especially IgG isotypes, in Western blotting, ELISA, IHC and other immunoassay protocols.

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Electron Microscopy Sciences

Collect forensic evidence with minimum interference and/or contamination from the sampler.

Supplier: Antyila Scientific

Accommodate 60° funnels, pear-shaped flasks, and round-bottom flasks.

Supplier: PIP

Combination of comfortable nylon shell, and a protective PU coating makes this glove ideal for use in electronic and computer assembly, quality control, inspection and general assembly.

Supplier: Triton Products

Mobile pegboard units offer maximum tool board storage versatility and strength with 32 sq. ft. of pegboard storage space.

Supplier: Anaspec

This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4, derived from the IRAK-1 activation loop peptide amino acids 360 to 380. This peptide sequence contains Ser-376, one of the primary phospho-acceptor residues of IRAK-1. IRAK-4 phosphorylates IRAK-1 as a key step in regulation of inflammatory signaling pathways.
Sequence:KKARFSRFAGSSPSQSSMVAR
MW:2285.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: FIREBIRD OPTICS

Water-jacketed dies suitable for producing discs of 3, 5, 6, 7, 8, 10, 13, 16, 20, 25, 32, 35 and 40 mm diameter as available as standard within the size range for the KB series. Non-standard sizes are available on request.

Supplier: Magid Glove

The Magid® T-REX® Flex Series® Lean TRX449 impact glove features a machine knit cut A4 Hyperon® shell and a crinkle latex palm coating.

Supplier: Enzo Life Sciences

Slow-binding competitive inhibitor of arginase I (Ki=0.4-0.6µM & KD=2.22µM for recombinant rat liver arginase) and arginase II (Ki=0.31µM at pH 7.5 and 0.03µM at pH 9.5 for human recombinant type II arginase). Enhances NO-dependent smooth muscle relaxation in human penile corpus cavernosum tissue. Does not inhibit nitric oxide synthase (NOS) and may serve as a valuable reagent to probe the physiological relationship between arginase and NOS. Inhibitor of rat aortic smooth muscle cell proliferation.

Supplier: Aladdin Scientific

Ammonium tungstate, also called ammonium paratungstate or APT is a white crystalline salt with a chemical formula either written (NH₄)10H₂(W₂O₇)6 or (NH₄)10(H₂W₁₂O₄₂). APT is extracted from tungsten ores and is the critical raw material for the production of tungsten metal. Additionally, it is employed in the manufacturing of catalysts, pigments, and specialty chemicals. Its applications extend to the electronics industry, where it is utilized in the production of electronic components and semiconductor materials due to its excellent thermal and electrical properties.

Supplier: Magid Glove

The Magid Greyt shadow guard terrycloth machine knit work gloves offer good thermal protection and strong cut and abrasion resistance with form-fitting comfort.

Supplier: HexArmor

The Hercules® 400R6E are no stranger to dangerous applications such as handling razor wire or protecting from animal bites. Gauntlet design and pre-curved shape for maximum comfort and protection.

Supplier: Anaspec

This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-NH2
MW: 1816.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Justrite

These Gas Cylinder Stands provide safety when moving and storing of gas cylinders.

Supplier: WISEBATCH LLC MS

The WiseBatch Fentanyl test strip has the ability to test for fentanyl and several analogues, including but not limited to: acetyl fentanyl, butryl fentanyl, furanyl fentanyl, acryl fentanyl, cyclopropyl fentanyl, 2-fluoro fentanyl, 3-fluoro fentanyl and 4-fluoro fentanyl. The test strip includes a micro scoop, simple instructions for use, as well as a scannable QR code that leads you to the resources section on our site where you can find a broad spectrum of testing education.

Supplier: Hygiena

The Hygiena™ BAX® System is an automated detection system that uses the power of the polymerase chain reaction (PCR) to detect foodborne pathogens, spoilage organisms and other microbes in raw ingredients, finished products and environmental samples.

Supplier: Anaspec

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: HiMedia

Iscove’s Modified Dulbecco’s Medium is an enriched modification of Dulbecco’s Modified Eagle’s Medium wherein serum can be partially or totally replaced by chemically defined substances.