30259 Results for: "agarose+powder"

Supplier: Thermo Scientific Chemicals

Good's buffer

Supplier: PIP

PVC coating resists diluted aqueous solutions of bases or acids and provides reliable resistance to oils and organic solvents, making these gloves suitable for mining, construction, refining, petrochemicals and handling oily materials.

Supplier: Justrite

These Gas Cylinder Barricade Rack Pallets with Ramp provide safety when moving and storing of gas cylinders.

Supplier: PIP

Side Split Cowhide leather construction provides comfort, durability, excellent abrasion resistance, and breathability. Ideal for welding and hot, heavy material handling.

Supplier: Anaspec

A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activity
Sequence:EPPLSQEAFADLWKK
MW:1759 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Magid Glove

The Magid® D-ROC® DXPG62 lightweight 13-gauge cut-resistant work gloves features DX+ Technology® for lightweight dexterity and cool comfort on the job.

Supplier: New Pig

Unlike clay, which is simply coated with liquid, fast-wicking recycled cellulose actually soaks up the spill the moment it touches

Supplier: Ward's Science

CAS Number: 1319-46-6
Formula: (PbCO₃)₂ • Pb(OH)₂
Formula Weight: 775.60
Freezing Point (°C): 400
Hazard Info: Toxic, Irritant
Shelf Life (months): 12
Solubility: Acids
Storage: Green
Synonyms: White Lead, Basic Lead Carbonate

Please Note: This product is designed for educational and teaching laboratories and no certificate of analysis is available.

Supplier: Thermo Fisher Scientific

Maximize lab space and flexibility with the easy to use, compact, programmable Thermo Scientific™ Digital Heating Cooling Drybath.

Supplier: MAPA

A tri-polymer exclusive that offers 100% comfort for optimal mechanical and chemical resistance.

Supplier: MP Biomedicals

Gentamicin sulfate is an aminoglycoside antibiotic complex produced by fermentation of Micromonospora purpurea or M

Supplier: Brady Worldwide

Labels function in temperatures ranging from –196 to +121 °C (–320 to +250 °F), and hot water baths.

Supplier: Ansell Healthcare

Economical solution for medium-duty applications requiring high cut resistance, grip, and oil-repelling performance in oily environments.

Supplier: Enzo Life Sciences

Highly selective and potent inhibitor of cyclooxygenase-2 (IC50=10nM for COX-2 versus IC50=17.8µM for COX-1) with antitumor properties. Exhibits longer half-life time and reduced gastric toxicity in fasting rat model. Has antitumor properties and has been shown to induce apoptosis and bFGF and VEGF-driven angiogenesis. Potent antimetastatic activity against both spontaneous metastases arising following primary tumour excision and experimental metastases.

Supplier: Vector Laboratories

Vector Laboratories alkaline phosphatase (AP) substrate options include standard substrates and ImmPACT substrates with higher sensitivity. The range of vibrant colors facilitates multiplex staining and improved contrast with pigmented tissues and counterstains.

Supplier: Justrite

This Safety Snap Cap for Gas Cylinders provides safety when moving and storing of gas cylinders.

Supplier: Avantor

The Rheo Continuous Liner is an excellent pack-off solution for transferring materials from a work process into a transport container while maintaining a high level of containment. Continuous Liners come in various sizes and can be configured to work with existing process equipment.

Supplier: Horizon Scientific

These Premier Series pharmacy refrigerators are freestanding and space effcient.

Supplier: Ansell Healthcare

TIG welding glove for precise welding and thermal jobs.

Supplier: Kewaunee

Three bay storage system to maximize storage capacity with divided trays, baskets and shelves.

Supplier: Anaspec

This FAM labeled peptide (Abs/Em=492/518 nm) is composed of gp91phox sequence linked to the human immunodeficiency virus (HIV)-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
MW: 3031.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Thermo Scientific Chemicals

MDL: MFCD00149813 Notes: m.p. 100°C -5H2O, 280°C -6H2O

Supplier: Thermo Scientific Chemicals

N-Boc-cis-4-hydroxy-D-proline methyl ester, 95%

Supplier: Thermo Scientific Chemicals

MDL: MFCD00036973

Supplier: LGC Standards

TRC Gentian Violet (~90%)

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Enzo Life Sciences

Slow-binding competitive inhibitor of arginase I (Ki=0.4-0.6µM & KD=2.22µM for recombinant rat liver arginase) and arginase II (Ki=0.31µM at pH 7.5 and 0.03µM at pH 9.5 for human recombinant type II arginase). Enhances NO-dependent smooth muscle relaxation in human penile corpus cavernosum tissue. Does not inhibit nitric oxide synthase (NOS) and may serve as a valuable reagent to probe the physiological relationship between arginase and NOS. Inhibitor of rat aortic smooth muscle cell proliferation.

Supplier: Magid Glove

The Magid Greyt shadow guard terrycloth machine knit work gloves offer good thermal protection and strong cut and abrasion resistance with form-fitting comfort.

Supplier: Electron Microscopy Sciences

Collect forensic evidence with minimum interference and/or contamination from the sampler.