30264 Results for: "agarose+powder"

Supplier: Magid Glove

These Magid® MultiMaster® Double Palm Gloves are feature with a clute pattern with two layers of 100% cotton fabric in vital wear areas such as the palm, thumb and the back of the index finger. These are also featuring with a 4" gauntlet/soft gauntlet cuff for protection well past the wrist.

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Magid Glove

The Magid® T-REX® Flex Series® Lean TRX449 impact glove features a machine knit cut A4 Hyperon® shell and a crinkle latex palm coating.

Supplier: FIREBIRD OPTICS

Water-jacketed dies suitable for producing discs of 3, 5, 6, 7, 8, 10, 13, 16, 20, 25, 32, 35 and 40 mm diameter as available as standard within the size range for the KB series. Non-standard sizes are available on request.

Supplier: Anaspec

Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Triton Products

Mobile pegboard units offer maximum tool board storage versatility and strength with 32 sq. ft. of pegboard storage space.

Supplier: Aladdin Scientific

Ammonium tungstate, also called ammonium paratungstate or APT is a white crystalline salt with a chemical formula either written (NH₄)10H₂(W₂O₇)6 or (NH₄)10(H₂W₁₂O₄₂). APT is extracted from tungsten ores and is the critical raw material for the production of tungsten metal. Additionally, it is employed in the manufacturing of catalysts, pigments, and specialty chemicals. Its applications extend to the electronics industry, where it is utilized in the production of electronic components and semiconductor materials due to its excellent thermal and electrical properties.

Supplier: Anaspec

This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4, derived from the IRAK-1 activation loop peptide amino acids 360 to 380. This peptide sequence contains Ser-376, one of the primary phospho-acceptor residues of IRAK-1. IRAK-4 phosphorylates IRAK-1 as a key step in regulation of inflammatory signaling pathways.
Sequence:KKARFSRFAGSSPSQSSMVAR
MW:2285.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: PIP

Combination of comfortable nylon shell, and a protective PU coating makes this glove ideal for use in electronic and computer assembly, quality control, inspection and general assembly.

Supplier: Electron Microscopy Sciences

Collect forensic evidence with minimum interference and/or contamination from the sampler.

Supplier: Antyila Scientific

Accommodate 60° funnels, pear-shaped flasks, and round-bottom flasks.

Supplier: Enzo Life Sciences

Slow-binding competitive inhibitor of arginase I (Ki=0.4-0.6µM & KD=2.22µM for recombinant rat liver arginase) and arginase II (Ki=0.31µM at pH 7.5 and 0.03µM at pH 9.5 for human recombinant type II arginase). Enhances NO-dependent smooth muscle relaxation in human penile corpus cavernosum tissue. Does not inhibit nitric oxide synthase (NOS) and may serve as a valuable reagent to probe the physiological relationship between arginase and NOS. Inhibitor of rat aortic smooth muscle cell proliferation.

Supplier: Magid Glove

The Magid Greyt shadow guard terrycloth machine knit work gloves offer good thermal protection and strong cut and abrasion resistance with form-fitting comfort.

Supplier: Justrite

Justrite™ laboratory safety cabinets are ideal for use with fume hoods.

Supplier: Thermo Scientific Chemicals

Sisomicin is a broad spectrum aminoglycoside antibiotic that targets the 30S ribosomal subunit resulting in an inability to read mRNA

Supplier: Antyila Scientific

CMUV Electromantles deliver the benefits of the CMU Electromantle, but do so for very large 60° funnels, as well as pear-shaped and round bottom flasks

Supplier: Invitrogen

Biotinylated recombinant Protein G can be used to probe and detect mouse and human antibodies, especially IgG isotypes, in Western blotting, ELISA, IHC and other immunoassay protocols.

Supplier: Anaspec

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Electron Microscopy Sciences

Gun Shot Residue Kit for Scanning Electron Microscopy.

Supplier: Horizon Scientific

These laboratory and pharmaceutical freezers offer premium protection for vaccine storage.

Supplier: PIP

Seamless knit nylon glove with polyurethane advanced barrier protection coating on full hand.

Supplier: Invitrogen

Pierce™ Recombinant Peroxidase Conjugated (HRP-Horseradish Peroxidase) Protein A/G is useful to probe and detect antibodies, especially IgG isotypes, of many different species hosts in Western blotting, ELISA, IHC and other immunoassay protocols.

Supplier: StatLab

The StatLab high capacity slide dryer is designed to provide maximum drying capacity for high volume laboratories. Air at a digitally controlled temperature is blown through the base of the instrument for rapid and efficient slide drying without the risk of overheating the specimen.

Supplier: H. WILSON COMPANY

Versatile AV cart, great for office or classroom use.

Supplier: Ace Glass

Complete self-supporting pilot plant assembly

Supplier: RHEO ENGINEERING LLC

The Rheo Continuous Liner is an excellent pack-off solution for transferring materials from a work process into a transport container while maintaining a high level of containment. Continuous Liners come in various sizes and can be configured to work with existing process equipment.

Supplier: Wells Lamont

The Y9258 gloves offer anti-static properties that rapidly neutralize the electric discharge for the worker and ESD properties that protect product equipment and workpieces. The ultra-lightweight liner provides excellent dexterity with ANSI Cut Level A4 protection to reduce hand injuries, and increased abrasion resistance and durability for prolonged use.

Supplier: MAPA

Unique tri-polymer construction offers 100% comfort for optimal mechanical and chemical resistance in cleanroom environments.

Supplier: Anaspec

A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activity
Sequence:EPPLSQEAFADLWKK
MW:1759 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Treston

Treston® lab benches are height adjustable in manual, motorized and hand crank versions. All bench frames can be equipped with casters to create a mobile workstation solution.