30264 Results for: "agarose+powder"
HyFlex® 11-931 Cut Resistant and Oil Repellent Gloves, Palm Coated, Ansell
Supplier: Ansell Healthcare
The lightest weight cut resistant and oil repellent glove providing enhanced worker comfort and safety, with strategically reinforced 'high wear' regions for extended-use life. These gloves are made up of Dyneema® diamond technology material.
Expand 6 Items
Leupeptin hydrochloride, MP Biomedicals
Supplier: MP Biomedicals
A modified tripeptide reversible protease inhibitor of trypsin-like proteases and some cysteine proteases including endoproteinase Lys-C, kallikrein, papain, thrombin, cathepsin B, cathepsins H and L, trypsin, calpain, trypsin and plasmin. Little to no inhibition is seen against pepsin, cathepsins A and D and alpha-chymotrypsin. When adjusted for molarity, all three salt forms are equally effective; however, the hydrochloride salt is usually less invasive in biological settings. Leupeptin, because of its aldehyde group, may act as a reducing agent and therefore interfere in protein determinations such as Lowry and, to a lesser extent, Bradford.
Expand 4 Items
MaxQ™ 6000 Digital Incubating and Refrigerating Stackable Orbital Shakers, Thermo Scientific
Supplier: Thermo Fisher Scientific
The MaxQ™ 6000 orbital shakers have been designed for plasmid purification, protein expression, genetic research, solubility studies, bacteria and yeast growth, metabolism studies, and hybridization applications
Expand 4 Items
Peristaltic Pumps, rotarus®, HIRSCHMANN
Supplier: Hirschmann
The rotarus® peristaltic pump series with a selection of different motors, varying housing safety classes and intelligent control of delivery volumes, covering a broad spectrum of application areas in the lab or industry. 50 and 100 W motors ensure precise delivery in speed ranges from 0.2 to 500 min⁻¹. This means that media with a high viscosity can also be accurately dispensed. Configuration data for basic parameters can also be stored in this manner an retrieved at any time. The flow and volume models have automatic blockage detection an tube rupture monitoring.
Expand 6 Items
Coomassie brilliant blue G-250 solution electrophoresis gel stain, ready-to-use
Supplier: G-Biosciences
G-Biosciences' Coomassie Brilliant Blue (CBB) G-250 and R-250 Stain are based on a colloidal Coomassie stain. CBB G-250 and R-250 stain proteins with high band visibility. The staining of gels with CBB G-250 and R-250 allows the examination of protein bands even during the staining process.
Expand 1 Items
Human C-peptide (57-87)
Supplier: Anaspec
C-peptide is cleaved from proinsulin, stored in secretory granules, and eventually released into the bloodstream in amounts equimolar with those of insulin. The measurement of the C-peptide is an important test for the beta-cell function. In the red blood cells of type 2 diabetic patients, Na+,K+ ATPase activity is strongly related to blood C-peptide levels. C-peptide signal transduction in human renal tubular cells involves the activation of phospholipase C and PKC-delta and PKC-varepsilon, as well as RhoA, followed by phosphorylation of ERK1/2 and JNK and a parallel activation of Akt. C-peptide shows specific binding to a G-protein-coupled membrane binding site, resulting in Ca2+ influx, activation of mitogen-activated protein kinase signalling pathways and stimulation of Na+, K+ ATPase and endothelial nitric oxide synthase.
Sequence: EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
MW: 3020.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Single Cylinder Hand Truck with Hoist Ring, Justrite®
Supplier: Justrite
This Single Cylinder Hand Truck with Hoist Ring provides safety when moving and storing of gas cylinders.
Expand 1 Items
SHIRACLEAN Industrial Ultrasonic Cleaners with Filtration, Elma
Supplier: Elma
SHIRACLEAN high capacity industrial ultrasonic cleaners are designed to clean a wide range of parts in industrial shops and laboratories. Application areas include removal of chips and coolant from machined parts, solder flux removal, injection mold cleaning, and 3-D mold support removal.
Expand 5 Items
Sanitizer Stand and Dispenser, Diversified Woodcrafts
Supplier: Diversified Woodcrafts
Essential for today's public spaces, a complete hand sanitizer unit that includes the stand and motion-activated, touchless gel dispenser.
Expand 2 Items
Antimony(III) potassium oxitartrate trihydrate 99.0-103.0% ACS
Supplier: Thermo Scientific Chemicals
MDL: MFCD00148863
Expand 3 Items
Rabies virus Chimeric Rabies Virus Glycoprotein Fragment
Supplier: Anaspec
This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.
Sequence:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
MW:4843.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Air Science USA® Downflow Workstations, DWS series, Air Science USA LLC
Supplier: Air Science
DWS Downflow Workstations are ductless fume hoods designed to protect the user and the environment from hazardous vapors generated on the work surface. Unrestricted front and side access permits applications requiring complex user involvement. Downward airflow in the chamber protects the operator.
Expand 2 Items
DURAN® protect+ Laboratory Bottles, Plastic Safety Coated, DIN 168-1 Thread, Graduated, Amber
Supplier: DWK Life Sciences (KIMBLE)
Multi-functional ambered glass laboratory bottles with UV protection and a protective safety coating.
Expand 8 Items
Coomassie brilliant blue G-250 electrophoresis gel stain
Supplier: G-Biosciences
G-Biosciences' Coomassie Brilliant Blue (CBB) G-250 and R-250 Stain are based on a colloidal Coomassie stain. CBB G-250 and R-250 stain proteins with high band visibility. The staining of gels with CBB G-250 and R-250 allows the examination of protein bands even during the staining process.
Expand 1 Items
Ciprofloxacin hydrochloride monohydrate
Supplier: MP Biomedicals
Ciprofloxacin is a fluorinated quinolone antibacterial agent which is highly effective against a broad spectrum of bacteria and mycoplasma.
Ciprofloxacin is most commonly used to treat infections of the skin, bone, sinus, lung, abdomen, and bladder. It can also be used to treat some sexually transmitted infections. Additionally, ciprofloxacin can be used after exposure to inhalation anthrax to reduce the chance of developing an infection.
During the proliferation phase of a bacterium a segmental twisting and untwisting of the chromosomes take place. An enzyme called DNA gyrase plays a decisive part in this process. Ciprofloxacin inhibits this DNA gyrase in a way that arrests the bacterial metabolism, since vital information can no longer be read from the bacterial chromosome. Ultimately, it affect DNA replication & cell division.
Store at +4 °C.
Expand 3 Items
Rectangular Table Series The Intermediate, BioFit
Supplier: BioFit
Easy to fold, highly mobile and engineered to last, The Intermediate rectangular table is built to fit everyone from students to adults and has a 74 cm (29") high surface height when deployed. Ergonomic ABS seats comfortably accommodate 12 users, providing 61 cm (24") of space for each occupant.
Expand 1 Items
Human Big Gastrin-1
Supplier: Anaspec
Big Gastrin is also referred to as Gastrin-34. Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach. Secreted by the G cells in the gastric mucosa, it is one of the major bioactive forms of gastrin found in tissue and plasma (the other bioactive form is gastrin-17 or little gastrin - Cat# AS-20750). Both gastrin-17 and gastrin-34 are carboxy-amidated and partially tyrosine sulfated. Binding of gastrin to the CCK2/gastrin receptor requires carboxy-amidation, however sulfation is not necessary for binding to the receptor. Binding of Gastrin to the CCK2/gastrin receptors on parietal cells of the stomach causes them to secrete hydrochloric acid (HCl) and stimulates lectin-like protein Reg expression via activation of PKC and RhoA. Gastrin also plays a role in release of Histamine and Pepsinogen.
Sequence: Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
MW: 3849.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Double Cylinder Hand Truck with Firewall and Hoist Ring, Justrite®
Supplier: Justrite
This Double Cylinder Hand Truck with Firewall and Hoist Ring provides safety when moving and storing of gas cylinders.
Expand 3 Items
HyFlex® 11-937 Cut Resistant and Oil Repellent Gloves, ³/₄ Coated, Ansell
Supplier: Ansell Healthcare
The lightest weight cut resistant and oil repellent glove providing enhanced worker comfort and safety, with strategically reinforced 'high wear' regions for extended-use life. These gloves are made up of Dyneema® diamond technology material.
Expand 6 Items
390 MMP FRET Substrate IV, Mca-DNP
Supplier: Anaspec
Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is readily hydrolyzed by MMP-8, 9 and collagenase-3 (MMP-13), Abs/Em = 325/393 nm. The hydrolysis is inhibited in a 1:1 stoichiometric fashion by the tissue inhibitors of metalloproteinases, TIMP-1, TIMP-2, and TIMP-3.
Sequence:Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
MW:1100.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
DURAN® protect+ Laboratory Bottles, Plastic Safety Coated, Wide Mouth, GLS 80, Graduated, Amber
Supplier: DWK Life Sciences (KIMBLE)
Multi-functional glass wide-mouth laboratory bottles with UV protection and a protective safety coating.
Expand 6 Items
PIG® Latching Drum Lid for Open-Head Steel Drums, New Pig
Supplier: New Pig
Latching handle easily opens and closes with one hand.
Expand 6 Items
ViscoMAX™ VML-1, Multi-Shaft Mixer, MorehouseCowles
Supplier: MorehouseCowles
MorehouseCowles ViscoMAX multi-shaft mixers are designed for dissolving extremely high viscosity materials of up to 4,000,000 cP. These mixers feature two to three shafts with each having its own specific function to ensure complete homogeneity. The VML-1 is offered in 0.25 to 0.75 gal capacity with 2 hp.
Expand 1 Items
AMD Balance Table with Isolation Area, Electron Microscopy Sciences
Supplier: Electron Microscopy Sciences
These workstations remove unwanted vibrations which limit the performance of sensitive instruments such as balances. Instruments are placed directly onto this isolation section of the workstation and isolations are removed by the built-in isolators.
Expand 3 Items
Coomassie® brilliant blue R-250 solution electrophoresis gel stain, ready-to-use
Supplier: G-Biosciences
G-Biosciences' Coomassie Brilliant Blue (CBB) G-250 and R-250 Stain are based on a colloidal Coomassie stain. CBB G-250 and R-250 stain proteins with high band visibility. The staining of gels with CBB G-250 and R-250 allows the examination of protein bands even during the staining process.
Expand 1 Items
MaxQ™ 6000 Digital Incubating and Refrigerating Stackable Orbital Shakers, 240 V
Supplier: Thermo Fisher Scientific
The MaxQ™ 6000 orbital shakers have been designed for plasmid purification, protein expression, genetic research, solubility studies, bacteria and yeast growth, metabolism studies, and hybridization applications
Expand 2 Items
gBAC Mini Genomic DNA Kits, IBI Scientific
Supplier: IBI Scientific
IBI gBAC Mini DNA Bacteria Kit is optimized for genomic and viral DNA purification from Gram (-) negative and Gram (+) positive bacterial cells
Expand 3 Items
Vernier® Circuit Board 2
Supplier: Vernier Software & Technology
The Vernier Circuit Board 2 is a basic electricity lab on a board. The turret terminals for every component make it easy to connect basic series and parallel circuits, examine the behavior of different components, and investigate RLC circuits. The Vernier Circuit Board 2 includes 10 bulbs, a resettable fuse, three powering options, 10 alligator clip leads, terminal clips to add components, and pre-installed components.
Expand 1 Items
NFF-3, Mca-DNP
Supplier: Anaspec
Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
NFF-3 is hydrolyzed rapidly by MMP-3 (kcat/Km = 218,000 s-1 M-1) and very slowly by MMP-9 (kcat/Km = 10,100 s-1 M-1), but no significant hydrolysis by MMP-1 and MMP-2. It is one of the few synthetic substrates selectively hydrolyzed by certain members of the MMP family and thus has important applications for the differentiation of MMP-3 activity from that of other MMPs. Abs/Em = 325/393 nm.
Sequence:Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
AASTY 11-50
Supplier: Cube Biotech
AASTYs (Acrylic acid-co-styrenes) - like AASTY 11-50 - are highly-alternating copolymers, well-suited for the generation of native lipid nanodiscs. They are a 2022 novel developed series for membrane protein solubilization & stabilization. AASTY 11-50 gets its name from its molecular weight and Acrylic Acid : Styrene Ratio. These varying ratios of acrylic acid to styrene contribute to the hydrophilic properties of our AASTYs. In general lighter AASTYs, like 6-45 tend to be more aggressive, while heavier AASTYs, such as 11-50 show higher thermodynamic stability.
Every membrane protein solubilization needs to undergo a screening process in before. The characteristic phospholipid environment surrounding the different membrane proteins in question performs differently well with each polymer. To support you in this process, we offer a handy Screening Kit for AASTYs to test them all.
We recommend the two following publications if you would like to get further information: Smith et al. 2020 & Timcenko et al. 2022