30267 Results for: "agarose+powder"

Supplier: Enzo Life Sciences

ß-Nicotinamide adenine dinucleotide phosphate (NADP-Na₂, oxidized form)

Supplier: MP Biomedicals

Aprotinin is a protein consisting of 58 amino acids, arranged in a single polypeptide chain that is crosslinked by three disulfide bridges. Aprotinin is found in bovine lymph nodes, lung, parotid gland, spleen, liver, pancreas, seminal vesicles, thyroid gland, kidney, mucous membranes of the trachea and esophagus, ovaries, heart, posterior pituitary and cartilage.

Supplier: MP Biomedicals

A highly active stable endopeptidase with a broad spectrum of action was isolated by E.

Supplier: HexArmor

Seamless, coated Helix® series 2085 gloves feature a 13-gauge, HPPE and fiberglass blend shell that offering 360° cut protection and provides ANSI/ISEA level A4 cut resistance. The flexible polyurethane palm coating provides superior grip and abrasion resistance in dry, wet, or oily situations while maintaining flexibility and durability.

Supplier: Transforming Technologies

The StaticCare™ ESD Cut Resistant Gloves combine powerful cut resistance, comfort, and uniform ESD protection into one superior performing glove. The gloves are certified ANSI Cut Level 3 while maintaining softness, flexibility, and comfort.

Supplier: Antyila Scientific

Simple-to-use, general-purpose water bath for your laboratory.

Supplier: Justrite

Justrite™ laboratory safety cabinets are ideal for use with fume hoods.

Supplier: HexArmor

The NXT™ 10-302 is an ambidextrous food service glove with SuperFabric® brand materials for coverage that targets primary knife strike areas, on top of a performance shell that makes it a true revolution in hand protection. Cool, comfortable, and provides great dexterity.

Supplier: Anaspec

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Mettler Toledo

The next generation of Micro-Analytical weighing has arrived. The XPR micro-analytical balances provide ultimate accuracy and quality assurance functions that are second to none.

Supplier: VWR International

VWR® Signature™ Vacuum Oven Station has a programmable Watlow temperature controller, that offers multiple ramp and soak capabilities, including storing and running up to 40 temperature profiles.

Supplier: Labconco

Popular models of Protector XStream Laboratory Hoods and supporting matching work surfaces (sold separately) are available from VWR® stock for immediate shipment

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Simplex Strip Doors

Equally effective in both permanent and temporary applications, these modular enclosures are designed, engineered, and manufactured to offer great flexibility

Supplier: MP Biomedicals

Isoamy alcohol is routinely used in molecular biology, especially in the purification of DNA. It is widely used in conjunction with phenol and chloroform (25:24:1 phenol : chloroform : isoamyl alcohol) for the removal of proteins from the nucleic acid solutions by extraction.

Supplier: HexArmor

The Bandit® 5042 is a heavy-duty leather work glove made in the USA with U.S. and imported components. With an interior layer of high-performance Corecept® technology, the 5042 provides industrial puncture protection against the most hazardous sharps and splinters found in the lumber industry.

Supplier: Thermo Fisher Scientific

Advanced Touch Screen Dry Baths/Block Heaters are designed to achieve precise temperature stability and uniformity with an easy-to-use touch screen

Supplier: G-Biosciences

Ellman's reagent is a versatile, water-soluble compound for quantifying free sulfhydryl groups in solution. It reacts with a free sulfhydryl group to yield a mixed disulfide and 2-nitro-5-thiobenzoic acid (NTB), a measurable yellow colored product at 412nm.
Ellman's reagent is very useful as a free sulfhydryl assay reagent due to its high specificity for -SH groups at neutral pH, high molar extinction coefficient and short reaction time.

Supplier: Mettler Toledo

The next generation of Analytical weighing has arrived. The XPR analytical balances provide ultimate accuracy and quality assurance functions that are second to none.

Supplier: Ansell Healthcare

Superior heat resistance with complete protection for the hand and wrist.

Supplier: Avantor

Top-of-the-range neoprene construction delivers excellent, wide-ranging chemical protection.

Supplier: Justrite

This Double Cylinder Hand Truck provides safety when moving and storing of gas cylinders.

Supplier: Justrite

These gas cylinder support brackets provide a quick and easy solution for storing gas cylinders when space is at premium.

Supplier: HexArmor

Helix® Series 1091 nylon seamless knit glove features a knit wrist to help prevent dirt and debris from entering the glove. A silicone-free, flexible foam nitrile palm coating provides superior grip and abrasion resistance on the job.

Supplier: Hach

This digital, combination gas-sensing ammonia ion selective electrode (ISE) with replaceable membrane module, refillable outer body, double junction reference and built-in temperature sensor is intended for laboratory use.

Supplier: MP Biomedicals

Paromomycin is a broad spectrum aminoglycoside antibiotic produced by Streptomyces rimosus var

Supplier: MP Biomedicals

β-NAD is one of the biologically active forms of nicotinic acid. It occurs in living cells primarily in the oxidized state. Serves as a coenzyme of the dehydrogenases, especially in the dehydrogenation of primary and secondary alcohols. NAD usually acts as a hydrogen acceptor, forming NADH which then serves as a hydrogen donor in the respiratory chain. (Merck Index, 12th Ed., No.6429)

Supplier: Thermo Scientific Chemicals

With bromide ion, catalyzes the liquid-phase auto-oxidation of cresols.

Supplier: Brady Worldwide

Ultra-aggressive metallized polyester (B-486B) is ideal for rating/serial plates that use barcodes, alphanumerics, graphic symbols, and logos, and require nameplate-like quality.