30267 Results for: "agarose+powder"

Supplier: MARCUS SOMMER

Practice basic pediatric care!

Supplier: Caron Products

Caron’s Heated Incubators offer controlled temperature conditions (10°C above ambient to 70°C)

Supplier: Selleck Chemicals

Clofarabine inhibits the enzymatic activities of ribonucleotide reductase (IC50 = 65 nM) and DNA polymerase.

Supplier: Thermo Scientific Chemicals

Manganese(IV) oxide is suitable for use in batteries. It is widely used for the selective oxidation of allylic and benzylic alcohols to aldehydes or ketones, as a co-oxidant in combination with 1,4-benzoquinone and in the allylic oxidation of olefins catalyzed by Palladium(II)­ acetate. It acts a reagent for oxidations. It is the source of manganese and all its compounds, largely used in manufacturing of manganese steel, for making amethyst glass, decolorizing glass, painting on porcelain, faience and majolica. The precipitate is used in electrotechnics, pigments, browning gun barrels, drier for paints and varnishes, printing and dyeing textiles.

Supplier: Brady Worldwide

Ultra Aggressive Metallized Polyester (B-486B) is ideal for rating/serial plates that use barcodes, alphanumerics, graphic symbols, and logos, and require nameplate-like quality.

Supplier: Fujifilm Irvine Scientific

Interleukin 33 (IL-33) is a member of the IL-1 cytokine family and is constitutively expressed in smooth muscle and airway epithelial cells. IL-33 signals through the interleukin 1 receptor-like 1 (IL-1R1) and interleukin-1 receptor accessory protein (IL1RAP) receptors to ativate NF-κB and MAPK signaling pathways. IL-33 functions to induce type 2 cytokine production in polarized Type 2 helper T (Th2) cells.

Supplier: Anaspec

This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Ansell Healthcare

Cost effective solution for lightweight applications requiring a durable coating and secure grip in oily environments.

Supplier: Enzo Life Sciences

ß-Nicotinamide adenine dinucleotide phosphate (NADP-Na₂, oxidized form)

Supplier: Ansell Healthcare

Unique knitted design allows the glove to easily tear at multiple high risk areas, significantly reducing the risk of hand injury if the glove becomes entangled in a rotating tool.

Supplier: Labconco

Popular models of Protector® Premier® Laboratory Hoods and supporting matching work surfaces (sold separately) are available from VWR® stock for immediate shipment

Supplier: Anaspec

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: MP Biomedicals

2XYT-Broth is a nutritional rich medium providing nitrogen and growth factors optimized for the growth of recombinant E. coli strains infected with the M13 bacteriophage or other filamentous single stranded DNA bacteriophages thus allowing the bacteriophage to reproduce in large quantities without exhausting the host cells.

Supplier: MilliporeSigma

The Overnight Express™ Autoinduction Systems enable regulated protein expression in E. coli, without monitoring the culture or adding inducer during cell growth.

Supplier: Labconco

Intelli-Sense™ Multi-Speed PVC Blowers handle extremely corrosive atmospheres produced by high order oxidizers such as perchloric acid

Supplier: MP Biomedicals

β-NAD is one of the biologically active forms of nicotinic acid. It occurs in living cells primarily in the oxidized state. Serves as a coenzyme of the dehydrogenases, especially in the dehydrogenation of primary and secondary alcohols. NAD usually acts as a hydrogen acceptor, forming NADH which then serves as a hydrogen donor in the respiratory chain.

Supplier: National Public Seating

The comfortable, institutional-grade 1200 Series premium upholstered folding chair is made with the combination of durable vinyl wrapped over 1¼" of soft foam on our most popular frame.

Supplier: Invitrogen

Thermo Scientific HisProbe-HRP is a nickel (Ni²⁺)-activated derivative of horseradish peroxidase (HRP) that enables direct, IMAC-based detection of His-tagged proteins and other histidine-rich proteins in Western blots and microplates.

Supplier: Justrite

These Gas Cylinder Barricade Racks provide safety when moving and storing of gas cylinders.

Supplier: FUJIFILM IRVINE SCIENTIFIC INC.

BalanCD CHO Growth A is a chemically-defined, animal component-free growth medium designed to increase process yields of antibodies and recombinant proteins in Chinese Hamster Ovary (CHO) cells. This formulation was developed using FUJIFILM Irvine Scientific’s rational culture media design strategy to achieve enhanced performance of growth and production in batch cultures.

Supplier: Labconco

Protector XL floor-mounted laboratory hoods with horizontal-sliding sashes are suitable for general chemistry applications and have the dimensions required for over-sized equipment.

Supplier: HexArmor

With a 13-gauge, flame-resistant aramid and wool blend shell offering 360° cut protection, the Helix® series 2083 glove provides protection against both hot and cold temperatures while maintaining a soft, dexterous feel.

Supplier: HexArmor

Helix® 2087 series gloves feature a flexible, foam nitrile palm coating for superior grip and abrasion resistance. The 13-gauge, HPPE and fiberglass blend shell offering 360° cut protection and provides workers with ANSI/ISEA level A4 cut resistance.

Supplier: Justrite

Steel cabinets store corrosive liquids and acids safely and securely, protecting both personnel and facilities.

Supplier: Ansell Healthcare

Lightest weight ANSI A4/ ISO Cut D glove featuring INTERCEPT™ Technology, these ultra-thin breathable gloves offer high cut resistance, while maintaining enhanced flexibility and tactility.

Supplier: Hygiena

The Hygiena™ BAX® System offers advanced, automated detection of foodborne pathogens, spoilage organisms and other microbes in raw ingredients, finished products and environmental samples.

Supplier: National Public Seating

The amazingly comfortable 1100 series polyfold fan-back folding chair offers the perfect solution for both indoor and outdoor seating events such as meetings, graduations and receptions. This lightweight institutional-grade chair provides the strengths of metal and all the benefits of plastic.

Supplier: Labconco

Popular models of Protector XStream Laboratory Hoods and supporting matching work surfaces (sold separately) are available from VWR® stock for immediate shipment

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.