30267 Results for: "agarose+powder"

Supplier: Antyila Scientific

Replace mercury manometers to elevate precision in vacuum measurements with portable or continuous-display absolute reference gauges.

Supplier: MONASHEE MANUFACTURING

A six-foot wide dust hood complete with discharge chute. Slagging hoods effectively capture and collect dust while providing uniform airflow, a clean work surface and protecting the operator from contaminants. These slagging hoods have a convenient steel post with a steel pad to hammer your lead buttons to remove the slag. There is also a chute where the slag is deposited for disposal. Designed for industrial and mining applications, our slagging hoods have a 10” flange for connecting to existing duct work and are required to be connected to an appropriately sized dust collector (sold separately, contact us for more information).

Supplier: HexArmor

The Chrome Series® 4026 features hi-vis color, back of hand impact protection, a synthetic leather palm and abrasion-resistant PVC dots for maximum grip.

Supplier: MP Biomedicals

Carnitine is a quaternary amine that occurs naturally in most mammalian tissue.
It is present in relatively high concentrations in skeletal muscle and heart where it is involved in regulating energy metabolism. It shifts glucose metabolism from glycolysis to glycogen storage and enhances the transport of long chain fatty acids into the mitochondria where they are oxidized for energy production.
Store at Room Temperature(15-30 °C), desiccate

Supplier: MP Biomedicals

Pepsin, an acid protease, contains a proteolytic enzyme. Pepsin contains the 'cathepsin' component which has milk curdling activity. It has a broad range of substrate activity and demonstrates an esterase acitivity. It generally attacks peptide bonds.

Supplier: Anaspec

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Magid Glove

The Magid® D-ROC® DXPG53 18-gauge work glove features DX+ Technology® for high cut protection with the flexible comfort of a coreless shell and a VersaTek Grip™ palm coating for extreme durability, dexterity, and grip in any environment.

Supplier: PIERCAN USA INC

Poly/CSM glovebox gloves combine the impermeability of polyisoprene with the chemical and radiation resistance of chlorosulfonated polyethylene (CSM). This hybrid design offers superior protection against gases, liquids, ozone, UV, and ionizing radiation.

Supplier: Wards

The next generation in laboratory burners. NextGen Bunsen Burners are designed to be the safest on the market.

Supplier: Labconco

Safely store and vent acids and other highly corrosive liquids.

Supplier: Janitorial Supplies

Effectively use desktop space with this mini organizer and keep your desk decluttered

Supplier: Ansell Healthcare

Ansell's lightest EN ISO cut D and ANSI/ISEA 105-2024 cut A4 glove (versus standard EN ISO cut D and ANSI/ISEA 105-2024 cut A4-rated gloves) offering three times greater cut resistance versus similar gloves made of standard HPPE yarn.

Supplier: Anaspec

This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: LGC Standards

Organic Standard, Penicilline V potassium 100 µg/mL in Methanol

Supplier: Thermo Fisher Scientific

Advanced Touch Screen Dry Baths/Block Heaters are designed to achieve precise temperature stability and uniformity with an easy-to-use touch screen

Supplier: Selleck Chemicals

Cladribine is an adenosine deaminase inhibitor for U266, RPMI8226, and MM1.S cells with IC50 of approximately 2.43, 0.75 and 0.18 μM, respectively

Supplier: FUJIFILM IRVINE SCIENTIFIC INC.

BalanCD™ CHO Feed 3 is a chemically-defined feed supplement of non-animal origin. Using Irvine Scientific’s Rational Culture Media Design® approach, this formulation has been developed to achieve high growth kinetics and product yield in fed-batch processes. The feed supplement contains balanced concentrations of glucose, amino acids, vitamins and trace elements to provide nutrients to leaner batch media that are needed to boost the productivity of the cell culture system in fed-batch.

Supplier: Ansell Healthcare

Unique knitted design allows the glove to easily tear at multiple high risk areas, significantly reducing the risk of hand injury if the glove becomes entangled in a rotating tool.

Supplier: Labconco

Popular models of Protector® Premier® Laboratory Hoods and supporting matching work surfaces (sold separately) are available from VWR® stock for immediate shipment

Supplier: Anaspec

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: MilliporeSigma

The Overnight Express™ Autoinduction Systems enable regulated protein expression in E. coli, without monitoring the culture or adding inducer during cell growth.

Supplier: Labconco

Intelli-Sense™ Multi-Speed PVC Blowers handle extremely corrosive atmospheres produced by high order oxidizers such as perchloric acid

Supplier: MP Biomedicals

2XYT-Broth is a nutritional rich medium providing nitrogen and growth factors optimized for the growth of recombinant E. coli strains infected with the M13 bacteriophage or other filamentous single stranded DNA bacteriophages thus allowing the bacteriophage to reproduce in large quantities without exhausting the host cells.

Supplier: MP Biomedicals

β-NAD is one of the biologically active forms of nicotinic acid. It occurs in living cells primarily in the oxidized state. Serves as a coenzyme of the dehydrogenases, especially in the dehydrogenation of primary and secondary alcohols. NAD usually acts as a hydrogen acceptor, forming NADH which then serves as a hydrogen donor in the respiratory chain.

Supplier: Justrite

These Gas Cylinder Barricade Racks provide safety when moving and storing of gas cylinders.

Supplier: Invitrogen

Thermo Scientific HisProbe-HRP is a nickel (Ni²⁺)-activated derivative of horseradish peroxidase (HRP) that enables direct, IMAC-based detection of His-tagged proteins and other histidine-rich proteins in Western blots and microplates.

Supplier: Anaspec

Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: National Public Seating

The comfortable, institutional-grade 1200 Series premium upholstered folding chair is made with the combination of durable vinyl wrapped over 1¼" of soft foam on our most popular frame.

Supplier: FUJIFILM IRVINE SCIENTIFIC INC.

BalanCD CHO Growth A is a chemically-defined, animal component-free growth medium designed to increase process yields of antibodies and recombinant proteins in Chinese Hamster Ovary (CHO) cells. This formulation was developed using FUJIFILM Irvine Scientific’s rational culture media design strategy to achieve enhanced performance of growth and production in batch cultures.