Order Entry
United States
Orders LinkContactUsLinkComponent
296 results for "Protein molecular weight markers"

296 Results for: "Protein molecular weight markers"

Sort By

Prestained Protein Ladder - Extra broad molecular weight (3 - 260 kDa), Abcam

Supplier: Abcam

Prestained Protein Ladder AB313996 is a combination of 11 pre-stained proteins with molecular weights from 3 to 260 kDa. This prestained protein ladder keeps track of the size and separation of proteins during SDS-polyacrylamide gel electrophoresis, approximating the target protein size and validating the Western transfer efficiency on PVDF, nylon, or nitrocellulose membranes.

Expand 1 Items
Loading...

Prestained Protein Ladder - Extra broad molecular weight (5 - 245 kDa), Abcam

Supplier: Abcam

5-245 kDa prestained protein ladder is a three-color protein standard with 13 prestained proteins. - Suitable for western blot (WB), SDS-PAGE - Designed for monitoring protein separation - Supplied in gel loading buffer and is ready to use

Expand 1 Items
Loading...

Precision Plus Protein™ Prestained Standards, Protein Markers, Bio-Rad

Supplier: Bio-Rad

Precision Plus Protein™ Prestained Standards are available in Dual Color, All Blue, Kaleidoscope™, and Dual Xtra options

Expand 9 Items
Loading...

Prestained Protein Ladder - Mid-range molecular weight (10 - 180 kDa), Abcam

Supplier: Abcam

10-180 kDa prestained protein ladder is a three-color protein standard with 10 pre-stained proteins. - Suitable for western blot (WB), SDS-PAGE - Designed for monitoring protein separation - Supplied in gel loading buffer and is ready to use

Expand 1 Items
Loading...

12 Epitope MBP Tag Protein Marker Lysate, Rockland Immunochemicals

Supplier: Rockland Immunochemical

12 Epitope MBP Tag Loading Control Protein Marker

Expand 1 Items
Loading...

Prestained Protein Ladder - Mid-range molecular weight (10 - 180 kDa), Abcam

Supplier: Abcam

Prestained Protein Ladder ab234617 is a blue protein standard with 11 pre-stained proteins covering a range of MW from 10-180 kDa. ab234617 is designed for monitoring protein seperation in SDS-polyacrylamide gel electrophoresis and verifying Western transfer efficiency on membranes (PVDF, nylon, or nitrocellulose) and for approximating the size of proteins.

Expand 1 Items
Loading...

Opal Prestained Protein Standard 3.5 to 245 kDa, Rockland Immunochemicals

Supplier: Rockland Immunochemical

Opal Prestained Protein Standard 3.5-245kDa

Expand 1 Items
Loading...

Sapphire Prestained Protein Standard 10 to 180 kDa, Rockland Immunochemicals

Supplier: Rockland Immunochemical

Sapphire Prestained Protein Standard 10-180kDa

Expand 1 Items
Loading...

Opal Prestained Protein Standard 10 to 245 kDa, Rockland Immunochemicals

Supplier: Rockland Immunochemical

Opal Prestained Protein Standard 10-245kDa

Expand 1 Items
Loading...

Opal Prestained Protein Standard 10 to 180 kDa, Rockland Immunochemicals

Supplier: Rockland Immunochemical

Opal Prestained Protein Standard 10-180kDa

Expand 1 Items
Loading...
WesternSure® Pre-stained Chemiluminescent Protein Ladder, LI-COR®

WesternSure® Pre-stained Chemiluminescent Protein Ladder, LI-COR®

Supplier: Li-Cor

WesternSure® chemiluminescent protein ladder is the only pre-stained, multi-colored protein ladder that provides film and digital detection.

Expand 1 Items
Loading...
Chameleon™ Duo Pre-stained Protein Ladder, LI-COR®

Chameleon™ Duo Pre-stained Protein Ladder, LI-COR®

Supplier: Li-Cor

These Pre-stained Protein Ladder provides multi-colored, pre-stained bands for visual inspection and two-color near-infrared detection

Expand 1 Items
Loading...
Lyophilized Protein Molecular Weight Standards

Lyophilized Protein Molecular Weight Standards

Supplier: Edvotek

Lyophilized for convenient storage. For 20 gels.

Expand 1 Items
Loading...

Perfect Protein™ Markers, MilliporeSigma

Supplier: MilliporeSigma

Ideal for routine use in SDS-polyacrylamide gel electrophoresis.

Expand 1 Items
Loading...

PROTEIN MOLECULAR WEIGHT MARKER 100UL

Supplier: BIOBASIC INC. MS

PROTEIN MOLECULAR WEIGHT MARKER 100UL

Expand 1 Items
Loading...

PROTEIN MOLECULAR WEIGHT MARKER (BROAD)

Supplier: Clontech Laboratories

PROTEIN MOLECULAR WEIGHT MARKER (BROAD)

Expand 1 Items
Loading...

PROTEIN MOLECULAR WEIGHT MARKER (HIGH)

Supplier: Clontech Laboratories

PROTEIN MOLECULAR WEIGHT MARKER (HIGH)

Expand 1 Items
Loading...

PROTEIN MOLECULAR WEIGHT MARKER (LOW)

Supplier: Clontech Laboratories

PROTEIN MOLECULAR WEIGHT MARKER (LOW)

Expand 1 Items
Loading...

Human Recombinant GDF15 (from E. coli)

Supplier: Rockland Immunochemical

Growth and Differentiation Factor 15 (GDF-15) is a TGFβ family member, made by the placenta and heart tissues, that has a role in regulating inflammatory and apoptotic pathways. GDF-15 has become an immerging marker of early heart disease and has the potential as being used as a molecule for screening patients for early heart failure. Recombinant human GDF-15 is a non-glycosylated, disulfide linked homodimer, containing two identical 113 amino acid chains, with a total molecular weight of 24.5 kDa.

Expand 3 Items
Loading...

Human Recombinant GDF15 (from E. coli)

Supplier: Rockland Immunochemical

Growth and Differentiation Factor 15 (GDF-15) is a TGFβ family member, made by the placenta and heart tissues, that has a role in regulating inflammatory and apoptotic pathways. GDF-15 has become an immerging marker of early heart disease and has the potential as being used as a molecule for screening patients for early heart failure. Recombinant human GDF-15 D is a non-glycosylated, disulfide linked homodimer, containing two identical 113 amino acid chains, with a total molecular weight of 24.5 kDa. There is a His to an Asp substitution at position 7.

Expand 3 Items
Loading...

Human Native beta2-Microglobulin

Supplier: Enzo Life Sciences

High purity, native protein used as a target diagnostic marker for cancer or renal failure.

Expand 1 Items
Loading...

Anti-TP63 Rabbit Polyclonal Antibody

Supplier: Prosci

p63 is a homolog of the tumor suppressor p53. It is identified in basal cells in the epithelial layers of a variety of tissues, including epidermis, cervix, urothelium, breast and prostate. p63 was detected in nuclei of the basal epithelium in normal prostate glands; however, it was not expressed in malignant tumors of the prostate. As a result, p63 has been reported as a useful marker for differentiating benign from malignant lesions in the prostate, particularly when used in combination with markers of high molecular weight cytokeratins and the prostate-specific marker AMACR (P504S). p63 has also been shown to be a sensitive marker for lung squamous cell carcinomas (SqCC), with a sensitivity of ~90%. Specificity for lung SqCC, vs. lung adenocarcinoma (LADC), is approximately 80%. In breast tissue, p63 has been identified in myoepithelial cells of normal ducts.

Expand 1 Items
Loading...
Anti-CD34 Mouse Monoclonal Antibody

Anti-CD34 Mouse Monoclonal Antibody

Supplier: Proteintech

CD34 is a surface glycophosphoprotein expressed on developmentally early lymphohematopoietic stem and progenitor cells with a molecular weight of about 105-120 kD. It is selectively expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification.

Expand 1 Items
Loading...

LyP-1, Peptide 1

Supplier: Anaspec

LyP-1 recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues. Screening on breast carcinoma xenografts shows positive to cyclic 9-amino-acid peptide, LyP-1. The LyP-1 also recognizes an osteosarcoma xenograft, and spontaneous prostate and breast cancers in transgenic mice. LyP-1 peptide is detected in tumor structures that are positive for several lymphatic endothelial markers and negative for blood vessel markers. LyP-1 accumulates in the nuclei of the putative lymphatic cells, and in the nuclei of tumor cells.
Sequence:CGNKRTRGC (S-S Bonded)
MW:992.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Gastrin Releasing Peptide

Supplier: Anaspec

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Sequence: VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
MW: 2859.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...
Anti-SOD2 Rabbit Polyclonal Antibody

Anti-SOD2 Rabbit Polyclonal Antibody

Supplier: Proteintech

SOD2(superoxide dismutase 2, mitochondrial ) is also named as IPOB, MNSOD, SODM, Mn-SOD and belongs to the iron/manganese superoxide dismutase family. It is a marker of mitochondria, which is restricted to the perinuclear area in a cell with aggregate formation of mutant SOD1. It functions as the first line of antioxidant defense against highly reactive superoxide radicals and it appears to be early predictors for survival in septic patients with with MIF. It has 2 isoforms with the molecular weight of 25 kDa and 21 kDa.

Expand 1 Items
Loading...

Toad Bombesin

Supplier: Anaspec

Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)

Supplier: Anaspec

FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.
Sequence: DRE-Dap(Nma)-APNLVYMVTG-Dpa-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
MW: 8314.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 2 Items
Loading...

Anti-KRT76 Mouse Monoclonal Antibody [clone: KRTH/1076]

Supplier: Prosci

This mAb recognizes basic (Type II or HMW) cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8). Twenty human keratins are resolved with two-dimensional gel electrophoresis into acidic (pI 6.0) subfamilies. The acidic keratins have molecular weights (MW) of 56.5, 55, 51, 50, 50 , 48, 46, 45, and 40kDa. Many studies have shown the usefulness of keratins as markers in cancer research and tumor diagnosis.

Expand 1 Items
Loading...

Anti-MUC1 Mouse Monoclonal Antibody [clone: MUC1/967]

Supplier: Prosci

This Epithelial Membrane Antigen / EMA antibody, also called MUC1 and Mucin-1, recognizes the full-length protein in a glycosylation-independent manner and can bind to the fully glycosylated protein. The dominant epitope of this mAb is APDTR in the VNTR region. It reacts with the core peptide of the EMA protein, which is a member of a family of mucin glycoproteins that are characterized by high carbohydrate content, O-linked oligosaccharides, high molecular weight (>200kDa) and an amino acid composition rich in serine, threonine, proline and glycine. The core protein contains a domain of 20 amino-acid tandem repeats that functions as multiple epitopes for the mAb. Incomplete glycosylation of some tumor-associated mucins may lead to variable unmasking of the multiple peptide epitopes leading to the observed differences in staining intensity between normal and malignant tissues. This EMA antibody reacts with both normal and malignant epithelia of various tissues including breast and colon.

Expand 1 Items
Loading...
Sort By
Recommended for You