Order Entry
United States
Orders LinkContactUsLinkComponent
3796 results for "Cell Culture Solutions"

3796 Results for: "Cell Culture Solutions"

Sort By
Sodium pyruvate 11.00mg/ml 100 mM, sterile

Sodium pyruvate 11.00mg/ml 100 mM, sterile

Supplier: MP Biomedicals

Sodium pyruvate is used by cells as an easily accessible carbohydrate source. Additionally, it is involved with amino acid metabolism and initiates the Kreb′s cycle. The 100 mM solution should be diluted 1:100 for most cell culture. The use of sodium pyruvate in Wallen fermentation medium to enhance the conversion of oleic acid to 10-ketostearic acid by Bacillus sphaericus has been described. A protocol that uses sodium pyruvate to establish stably transfected human B cell lines has been published. It improves coliform recovery when present in culture medium.

Expand 1 Items
Loading...
Phosphate Buffered Saline, 100 ml

Phosphate Buffered Saline, 100 ml

Supplier: RPI

PBS, 100 ml tablets refer to pre-weighed tablets that are used to prepare a specific volume of PBS (Phosphate Buffered Saline) solution. PBS is a widely used buffer solution in biological and biochemical research. PBS serves as a versatile buffer for various applications, including cell culture, immunohistochemistry, protein and nucleic acid research, and diagnostic assays. It helps maintain a stable pH and osmolarity, providing optimal conditions for biological reactions and preserving the integrity of cells and biomolecules.

Expand 2 Items
Loading...
Phenol red sodium salt solution 0.5%, dark red solution

Phenol red sodium salt solution 0.5%, dark red solution

Supplier: MP Biomedicals

Phenol red is an acid-base indicator. It is made by condensing two moles of phenol with one mole of o-sulfobenzoic acid anhydride.
Phenol Red is used as a pH indicator in cell culture applications. A solution of phenol red will have a yellow color at a pH of 6.4 or below and a red color at a pH of 8.2 and above. Phenol red in tissue culture media can act as a weak estrogen, especially with human breast cancer cells. Phenol red can be used to measure hydrogen peroxide in cultured macrophages in multiwell plates.
Store at Room Temperature (15-30 °C)

Expand 1 Items
Loading...

Phenol red sodium salt

Supplier: Adipogen

Water soluble pH indicator used in the 6.8 (yellow) to 8.2 (red) range and frequently used in cell biology laboratories. Widely used as cell tissue culture pH marker. A small amount of phenol red added to the growth medium will have a pink-red color under normal conditions. Typically, 15 mg/l are used for cell culture. In the event of problems, waste products produced by dying cells or overgrowth of contaminants will cause a change in pH, leading to a change in indicator color. For example, a culture of relatively slowly dividing mammalian cells can be quickly overgrown by bacterial contamination. This usually results in an acidification of the medium, turning it yellow. The waste products produced by the mammalian cells themselves will slowly decrease the pH, gradually turning the solution orange and then yellow. This color change is an indication that even in the absence of contamination, the medium needs to be replaced. Shown to be a weak estrogen mimic (possible through inpurities), which can enhance the growth of cells that express the estrogen receptor in cell cultures. Might be useful as a differentiation factor.

Expand 3 Items
Loading...
Phosphate buffered saline

Phosphate buffered saline

Supplier: RPI

PBS, 200 ml tablets refer to pre-weighed tablets used to prepare a specific volume of PBS (Phosphate Buffered Saline) solution. The buffer tablets are commonly used buffer solution in biological and biochemical research. PBS serves as a versatile buffer for various applications, including cell culture, immunohistochemistry, protein and nucleic acid research, and diagnostic assays. It helps maintain a stable pH and osmolarity, providing optimal conditions for biological reactions and preserving the integrity of cells and biomolecules.

Expand 1 Items
Loading...
Human Vitronectin

Human Vitronectin

Supplier: Advanced Biomatrix

Vitronectin is a monomeric glycoprotein used to promote cell attachment, migration, proliferation and differentiation in a broad number of cell lines and types. This product has been purified from human plasma where it is found as a mixture of 75kDa and 65kDa polypeptides.

Vitronectin’s primary use in cell culture is related to cell adhesion. It also binds to heparin and collagen.

Vitronectin is ideal for coating of surfaces. The optimal concentration for cell attachment and culture may differ for various cell types. Vitronectin has been used at a final coating concentration as low as 50 ng/cm2 on plasticware. It is provided in user-friendly packaging for use and storage. Vitronectin is sterile filtered and is supplied as a ready to use solution after thawing and concentration adjustment. This product is shipped separately on dry ice.

Expand 1 Items
Loading...

VersaLyse™ Lysing Solution, 100 Tests, RUO

Supplier: Beckman Coulter

VersaLyse Lysing solution is a reagent used to lyse red blood cells from any biological fluid and, in particular, to lyse erythrocytes from whole blood. VersaLyse is a highly specific, very gentle lysing solution, suitable for applications such as immunophenotyping, cell sorting, activation or cell culture. It is designed for use in flow cytometry and facilitates obtaining highly discriminative scattergrams whatever the type of flow cytometer used. VersaLyse is a versatile reagent which may be used in lyse/wash, wash/lyse and lyse/no-wash procedures with undiluted or diluted samples. The histograms are dual-parameter light scatter histograms (FS versus SS) of a normal K3EDTA anticoagulated blood sample lysed with VersaLyse Lysing Solution (No-wash procedure).

Expand 1 Items
Loading...

β-(N-Morpholino)ethanesulfonic acid (MES) hydrate ≥99%

Supplier: Thermo Scientific Chemicals

MES hydrate is a zwitterionic N-substituted aminosulfonic acid, known as Good?s buffer, is utilized for many biological applications. It is a useful resolving agent for very small proteins on bis-tris gels. It is mainly used as a biological buffer in plant cell cultures. Buffer solutions are used as a means of keeping pH at a nearly constant value in a wide variety of chemical applications.

Expand 2 Items
Loading...
Corning® EDTA, 0.5M pH 8.0, Corning

Corning® EDTA, 0.5M pH 8.0, Corning

Supplier: Corning

EDTA (ethylenediaminetetraacetic acid) is a polyamino carboxylic acid. It is a colorless, water-soluble solid and is useful as a chelating agent due to its ability to "sequester" metal ions such as Ca2+ and Fe3+.  These cations are responsible for various undesirable effects in molecular biological and cell culture processes. After being bound by EDTA, these metal ions remain in the solution but exhibit diminished reactivity.  The use of EDTA therefore allows for greater control over many experiments.

Expand 1 Items
Loading...
Digital Transmitted Light Microscope, AE2000

Digital Transmitted Light Microscope, AE2000

Supplier: Motic

The AE2000 digital transmitted light microscope is Motic's new model of inverted microscope equipped with Moticam BMH4000X, providing a flexible optical concept to meet best image quality and robust design for a long lifetime under rough lab conditions. This is the perfect microscope solution for routine cell culture in clinical and pharmaceutical laboratories, also offering best options for university teaching.

Expand 1 Items
Loading...
PureCol® Bovine Collagen Type I

PureCol® Bovine Collagen Type I

Supplier: Advanced Biomatrix

PureCol® EZ Gel is a ready-to-use collagen solution that forms a firm gel by simply warming to 37°C in an incubator. The product consists of purified Type I collagen at a concentration of 0.5%, (~5 mg/ml), DMEM/F-12 medium and a mixture of L-glutamine and dipeptide (L-alanine-L-glutamine) to provide a long-lasting L-glutamine source for cell culture.
PureCol® EZ Gel is designed to improve gel consistency by pre-formulation of the medium and adjustment of the product to a neutral pH. This product avoids the inconsistencies in the preparation of the gel that can arise through variables of reagent addition, pH adjustment and handling conditions.

PureCol® EZ Gel is ideal for providing a firm gel and can also be used in the preparation of a thin layer for culturing cells. PureCol® EZ Gel collagen is provided in a user-friendly packaging for use and storage. This product is sterile and supplied as a ready to use solution.

Expand 1 Items
Loading...
Vivapure® Adenovirus Purification Kits, AdenoPACK, Sartorius

Vivapure® Adenovirus Purification Kits, AdenoPACK, Sartorius

Supplier: Sartorius

The Vivapure® AdenoPACK™ adenovirus purification and concentration kits provides researchers who need to recover up to 3×1013 purified recombinant adenovirus particles for in vitro transfection a fast, safe and easy to use solution. The kits include all reagents and devices necessary for clarification, purification and concentration of adenovirus type 5 from HEK293 cell cultures.

Expand 6 Items
Loading...
BTXpress™ Cytoporation® Electroporation Buffer, Medium T and T4

BTXpress™ Cytoporation® Electroporation Buffer, Medium T and T4

Supplier: Harvard Apparatus

BTXpress Cytoporation® Media T/T4 is an advanced electroporation buffer designed for use with the BTX AgilePulse MAX™ large volume electroporation system for in vitro delivery of DNA, RNA, oligonucleotides, and siRNA. The low conductivity buffer is specially formulated to minimise heating of solution during large volume electroporation for maximum transfection efficiency and high cell viability. BTXpress Cytoporation® Media T and T4 are sterile filtered from the highest quality non animal, medical grade reagents. Buffer can be directly diluted in complete growth media for post electroporation cell culture.

Expand 1 Items
Loading...
Poly-D-lysine 0,1 mg/mL

Poly-D-lysine 0,1 mg/mL

Supplier: Advanced Biomatrix

Poly-D-Lysine is a synthetic amino acid chain that is positively charged and widely used as a coating to enhance cell attachment and adhesion to both plasticware and glass surfaces. This molecule is resistant to enzymatic degradation and has been used to culture a wide variety of cell types.
The molecular weight of Poly-D-Lysine can vary significantly with lower molecular weight (30,000 Da) being less viscous and higher molecular weight (>300,000 Da) having more binding sites per molecule. This product’s molecular weight ranges from 70,000 to 150,000 Da yielding a solution viscosity for easy handling while providing sufficient binding sites for cell attachment.

Poly-D-Lysine surface coatings are designed to improve cell attachment, growth and differentiation of many cell types. Coated surfaces will often improve cell attachment in reduced or serum-free conditions. Poly-D-Lysine is supplied in a sterile 5 mg package size.

Expand 1 Items
Loading...
Poly-L-Lysine

Poly-L-Lysine

Supplier: Advanced Biomatrix

Poly-L-Lysine is a synthetic amino acid chain that is positively charged having one hydrobromide per unit of Lysine. Poly-L-Lysine is widely used as a coating to enhance cell attachment and adhesion to both plasticware and glass surfaces. This molecule has been used to culture a wide variety of cell types. Certain cell types secrete proteases, which can digest Poly-L-Lysine. For those cell types, Poly-D-Lysine 000 Da) being less viscous and higher molecular weight (>300,000 Da) having more binding sites per molecule. This product’s molecular weight ranges from 70,000 to 150,000 Da yielding a solution viscosity for easy handling while providing sufficient binding sites for cell attachment.

Poly-L-Lysine surface coatings are designed to improve cell attachment, growth and differentiation of many cell types. Coated surfaces will often improve cell attachment in reduced or serum-free conditions. This product is supplied in a sterile 50 ml package size at a concentration of 0.1 mg/ml.

Expand 1 Items
Loading...
TeloCol® Bovine Telocollagen Type I

TeloCol® Bovine Telocollagen Type I

Supplier: Advanced Biomatrix

TeloCol®-3 bovine collagen solution is derived from an acid extraction process yielding a telopeptide-intact collagen. The pro-peptide regions at both ends of the collagen chain, N- and C-telopeptide regions, are maintained.

TeloCol®-3 collagen is approximately 95% Type I collagen with the remainder being comprised of Type III collagen. Each product includes a bottle containing 50 ml of collagen solution accompanied with a bottle of pre-formulated neutralizing solution for the formation of a collagen gel. This product is supplied at a concentration of approximately 3 mg/ml with the concentration for each specific lot provided on the product label and Certificate of Analysis that is available with the purchase of each product. TeloCol®-3 is sterile filtered and provided in user-friendly packaging for use and storage.

TeloCol®-3 is ideal for coating of surfaces, providing preparation of thin layers for culturing cells, or use as a solid gel.

Expand 1 Items
Loading...

TeloCol® Bovine Telocollagen Type I

Supplier: Advanced Biomatrix

TeloCol®-6 bovine collagen solution is derived from an acid extraction process yielding a telopeptide-intact collagen. The pro-peptide regions at both ends of the collagen chain, N- and C-telopeptide regions, are maintained.

TeloCol®-6 collagen is approximately 95% Type I collagen with the remainder being comprised of Type III collagen. Each product includes a bottle containing 50 ml of collagen solution accompanied with a bottle of pre-formulated neutralizing solution for the formation of a collagen gel. This product is supplied at a concentration of approximately 6 mg/ml with the concentration for each specific lot provided on the product label and Certificate of Analysis that is available with the purchase of each product. TeloCol®-6 is sterile filtered and provided in user-friendly packaging for use and storage.

TeloCol®-6 is ideal for coating of surfaces, providing preparation of thin layers for culturing cells, or use as a solid gel.

Expand 1 Items
Loading...
Vivapure® LentiSELECT, Lentivirus Purification Kits, Sartorius

Vivapure® LentiSELECT, Lentivirus Purification Kits, Sartorius

Supplier: Sartorius

LentiSELECT kits offer LentiSELECT 40, LentiSELECT 500 and LentiSELECT 1000 for the purification and concentration of VSV-G pseudotyped lentivirus from 40 to 1000 ml cell culture, leading to purified infective particles. These lentivirus purification and concentration kits offer purified recombinant lentivirus particles for in-vitro transfection a fast, safe and easy to use solution. These kits replace time-consuming ultracentrifugation protocols, which typically take about one day for large sample volumes, thus reducing the purification time to only a few hours.

Expand 3 Items
Loading...
Bovine Collagen Type II

Bovine Collagen Type II

Supplier: Advanced Biomatrix

Bovine Collagen Type II is one of a family of proteins found particularly in the flesh and connective tissues of mammals (approximately one-third of the body’s total protein). Over two dozen types of collagen have been described; Type II is found predominantly in hyaline cartilage (50% of the protein in hyaline is collagen type II) and is also found in the vitreous humor of the eye.

The product is supplied as a sterile solution at approximately 0.5 mg per vial at approximately ~.50 mg/ml in 500 mM acetic acid. A certificate of Analysis is available with the purchase of each product. Type II collagen is provided in user-friendly packaging for use and storage. Type II collagen may be used to culture a variety of cell types. Type II collagen is typically used as a coating material for cell culture studies, for the formation of 3D collagen gels, or as an antigen for antibody production.

Expand 1 Items
Loading...

HEPES-2-[4-(2-Hydroxyethyl)-1-piperazinyl]-ethanesulfonic acid ≥99%, Ultrapure biological buffer

Supplier: Spectrum Chemical Mfg. Corp.

HEPES, Biological Buffer, Ultrapure is as it's name suggests, a buffering agent. It's a zwitterionic organic chemical that is one of the '20 Good's buffers. Because it's better at maintaining physiological pH despite changes in carbon dioxide, it is widely used in cell culture. It has a decrease of water dissociation with falling temperature, this is especially relevant when working at low temperatures as it maintains enzyme function and structure. That said, it is important when working with HEPES for that particular purpose to keep the HEPES-containing solution in darkness as much as possible

Expand 4 Items
Loading...

HEPES-2-[4-(2-Hydroxyethyl)-1-piperazinyl]-ethanesulfonic acid ≥99% biological buffer

Supplier: Spectrum Chemical Mfg. Corp.

HEPES, Biological Buffer is as it's name suggests, a buffering agent. It's a zwitterionic organic chemical that is one of the '20 Good's buffers.' Because it's better at maintaining physiological pH despite changes in carbon dioxide, it is widely used in cell culture. It has a decrease of water dissociation with falling temperature, this is especially relevant when working at low temperatures as it maintains enzyme function and structure. That said, it is important when working with HEPES for that particular purpose to keep the HEPES-containing solution in darkness as much as possible

Expand 4 Items
Loading...

Tween® 80 (Polysorbate), liquid, Cell Culture Grade

Supplier: MP Biomedicals

Tweens® are a series of nonionic surfactants derived from sorbitan esters. They are soluble or dispersible in water but differ widely in organic and oil solubilities. Used as oil-in-water emulsifiers in pharmaceuticals, cosmetics, cleaning compounds, etc.
Tween® 80 has been widely used in biochemical applications including: solubilizing proteins, isolating nuclei from cells in culture selective protein extraction growing of tubercule bacilli, and emulsifying and dispersing substances in medicinal and food products. It has little or no activity as an anti-bacterial agent. It has been shown to have an adverse effect on the antibacterial effect of methyl paraben and related compounds. Non-ionic detergent used for selective protein extraction and isolation of nuclei from mammalian cell lines.
Soluble/miscible in water to give a clear yellow solution; miscible with alcohol, dioxane, and ethyl acetate; practically insoluble in liquid paraffin and fixed oils (such as mineral oil).
Autoclaving of solutions is not recommended. Sterile filtering is suggested with a 0.22 micron filter. Tween® may need to be warmed to about 40 °C and alternated with portions of hot distilled water while being poured through the filter.
Store at Room Temperature (15-30 °C).

Expand 2 Items
Loading...

Human [Gln22, Asn23]-beta-Amyloid (1-40)

Supplier: Anaspec

This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Dimethyl sulfoxide for molecular biology

Supplier: MP Biomedicals

Storage: Room Temperature, desiccate, store under nitrogen.
Dimethyl Sulfoxide is a dipola, aprotic solvent. It has been shown to accelerate strand renaturation (1-10% concentration) and is believed to give the nucleic acid thermal stability against depurination.
Dimethyl Sulfoxide is used to enhance dermal absorption of many chemicals, as a solvent for many organic and inorganic compounds including fats, carbohydrates, dyes, resins, and polymers, in antifreeze or hydraulic fluids, as a cryopreservative for cell cultures, oxidation of thiols and disulfides to sulfonic acids, as a PCR cosolvent to help improve yields, especially in long PCR. DMSO is routinely used in polymerase chan reaction (PCR), amplification of cDNA libraries, DNA sequencing, column-loading buffers for poly (A)+ RNA selection, buffers for the transformation of competent E. coli, and transfection protocols.
To prepare sterile solutions use a teflon or nylon membrane to sterile-filter the DMSO - do not use a cellulose acetate membrane.

Expand 3 Items
Loading...

Glycine ≥99% for molecular biology

Supplier: MP Biomedicals

Storage: Store at Room Temperature (15-30 °C)
Glycine is a non-essential amino acid. It is only amino acid with no asymmetric carbon and thus is not chiral. It is the major inhibitory neurotransmitter. It is involved in the biosynthesis of the porphyrin rings of hemes and chlorophylls.
Glycine is commonly used in buffer solutions, in electrophoresis and preparative chromatography. A study of the folding of monoclonal antibodies in the presence of glycine and their subsequent purification has been published. The use of glycine in the purification of lipopolysaccharides, lipooligosaccharides, and lipid A has been reported. It is an amino acid for use in cell culture media development applications and existing media formulations. Glycine is commonly used as a component in Tris-glycine and Tris-glycine-SDS running buffers for polyacrylamide gel electrophoresis, a component of Towbin's transfer buffer for Western blots, a buffer substance in cryoenzymology, in osmotic pressure maintenance in isoelectric focusing of erythrocytes, salting-in effect in protein chemistry, and as a buffer component in the coupled phosphatase-kinase reaction for end labelling of restriction fragments. The growth requirements of various microorganisms is reported in the Handbook of Microbiology.
Glycine is a non-chiral amino acid that can be synthesized in the body from the amino acid serine by Serine Hydroxymethyltransferase. Inhibitory neurotransmitter in spinal cord, allosteric regulator of NMDA receptors.

Expand 4 Items
Loading...
Urea ≥99%, white prills, Ultrapure

Urea ≥99%, white prills, Ultrapure

Supplier: MP Biomedicals

Urea is the principal end product of nitrogen metabolism in most mammals, formed by the enzymatic reactions of the Kreb's cycle.
Urea is a mild agent usually used in the solubilization and denaturation of proteins. It is also useful for renaturing proteins from samples already denatured with 6 M guanidine hydrochloride such as inclusion bodies; and in the extraction of the mitochondrial complex. It is commonly used to solubilize and denature proteins for denaturing isoelectric focusing and two-dimensional electrophoresis and in acetic acid-urea PAGE gels. Urea is used in cell or tissue culture media to increase the osmolality. Urea has also been used as fertilizer because of the easy availability of nitrogen; in animal feeds; it is reacted with aldehydes to make resins and plastics; condensed with malonic ester to form barbituric acid; used in the paper industry to soften cellulose; used as a diuretic; enhances the action of sulfonamides; an antiseptic.
Urea in solution is in equilibrium with ammonium cyanate. The form that reacts with protein amino groups is isocyanic acid. Urea in the presence of heat and protein leads to carbamylation of the proteins. Carbamylation by isocyanic acid interferes with protein characterization because isocyanic acid reacts with the amino terminus of proteins, preventing N-terminal sequencing. Isocyanic acid also reacts with side chains of lysine and arginine residues resulting in a protein that is unsuitable for many enzymatic digests. In addition, carbamylation often leads to confusing results from peptides having unexpected retention times and masses. When performing enzymatic protein digests it is important to remove urea first. Even though some enzymes will tolerate small amounts of urea, the elevated temperature used for most reactions will lead to carbamylation during the course of the digest. The urea can be removed prior to digestion by fast reversed phase chromatography, spin columns, or dialysis.
Dissolve urea in deionized water to the desired concentration.For every 10 ml of solution, add 1 g of Amberlite® IRA-910.Stir for one hour at room temperature

Expand 4 Items
Loading...
Prefilled Bouin's Solution, Azer Scientific

Prefilled Bouin's Solution, Azer Scientific

Supplier: VWR International

Bouin's fixative is a saturated picric acid-formalin solution that is useful for preserving and fixing delicate tissues and gastrointestinal tract specimens.

Expand 3 Items
Loading...
VWR® Sodium Phosphate 0.1 M, pH 7.0 Buffer

VWR® Sodium Phosphate 0.1 M, pH 7.0 Buffer

Supplier: VWR International

Made with sodium phosphate monobasic monohydrate, sodium hydroxide solution and deionized water.

Expand 1 Items
Loading...
VWR® Round Media Bottles

VWR® Round Media Bottles

Supplier: VWR International

Disposable round media bottles for storing sterile solutions such as tissue culture media, serum, and buffers.

Expand 4 Items
Loading...
Buffer Solution

Buffer Solution

Supplier: Ward's Science

Buffer solution has a shelf life of 24 months

Expand 20 Items
Loading...
Sort By
Recommended for You