19106 Results for: "AP+physics"

Supplier: Promega Corporation

PNGase F is a recombinant glycosidase cloned from Elizabethkingia miricola and overexpressed in E. coli. PNGase F has a molecular weight of 36kDa.

Supplier: MP Biomedicals

Tunicamycin is a mixture of Tunicamycins A, B, C and D. It is a nucleoside antibiotic active in vitro against Gram-positive bacteria, yeasts, fungi, and viruses.

Supplier: Thermo Scientific Chemicals

Sequestering agent, buffer, photography

Supplier: Thermo Scientific Chemicals

Powder

Supplier: Thermco

These high precision liquid-in-glass mercury thermometers are hand blown, which bear graduations, numbers and letters etched into the glass and filled with and inert gas above the mercury column

Supplier: Thermo Scientific

SureSTART™ Level 2 WebSeal™ 96-Well Total V-Bottom microtiter plates are designed to ensure high quality data with an uninterrupted workflow for high-throughput GC and HPLC/UHPLC applications.

Supplier: Cytiva

HiPrep SP HP 16/10 is a strong cation exchanger designed for preparative ion exchange chromatography separations. This 20 mL column is prepacked with SP Sepharose High Performance chromatography resin. The resin is based on rigid, highly cross-linked beaded agarose with a mean bead diameter of 34 µm for high resolution separations.

Supplier: Thermo Scientific Chemicals

MDL: MFCD00066973 Beilstein Registry No.: 3730764 Fieser: 20,254

Supplier: Anaspec

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: WORLD PRECISION INSTRUMENTS LLC

Mouse/rat restrainer for use with the non-invasive blood pressure system.

Supplier: Ansell Healthcare

BioClean™ Synergy™ Non sterile Nitrile Gloves are hypoallergenic and accelerator-free.

Supplier: Thermo Scientific Chemicals

Iron (II) oxalate dihydrate 99%

Supplier: Cytiva

Mono-sized 15 um rigid beads gives low back pressure and high flow rates allowing for high productivity.

Supplier: Thermo Scientific

SureSTART™ Level 1 WebSeal™ 96-Well Square U-Bottom Mid-well plates are designed for everyday chromatography analysis.

Supplier: Cloud-Clone

Monoclonal Antibody to Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3a), derived from recombinant MAP1LC3a (Met1~Gly120), is reactive with Human/Mouse/Rat/Pig.

Supplier: Cloud-Clone

This assay has high sensitivity and excellent specificity for detecting Human HPSE (Heparanase). The assay range is from 31.2 to 2000 pg/ml (Sandwich kit) with a sensitivity of 13.3 pg/ml. There is no detectable cross-reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.

Supplier: Cloud-Clone

This assay has high sensitivity and excellent specificity for detecting Human CLDN5 (Claudin 5). The assay range is from 0.156 to 10 ng/ml (Sandwich kit) with a sensitivity of 0.057 ng/ml. There is no detectable cross-reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.

Supplier: Intact Genomics

T4 DNA ligase displays significantly higher ligation efficiency than the nearest competitor.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein(ABR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Supplier: Thermo Scientific Chemicals

This solution contains 30% methanol, 5% acetic acid, 0.2% Brilliant Blue G.

Supplier: Thermo Scientific Chemicals

Ammonium thiocyanate has many uses in manufacturing chemicals such as metal thiocyanates [CuSCN, Ca(SCN)2, NaSCN, KSCN], and in a number of pharmaceuticals. It is used in freezing solutions, pickling, printing, and corrosion inhibitor against acid gases. It is used in photography industry as a stabilizer or accelerator. Used in fertilizers, fabric dyeing, zinc coating, electroplating, and as a separator of Zr and Hf, also Au and Fe.

Supplier: Cytiva

SOURCE™ 30Q is a synthetic high performance, preparative, chromatography medium, based on a 30 µm monosized, rigid polystyrene/divinyl benzene polymer matrix.

Supplier: VWR International

Ensure optimal performance from your Masterflex® B/T series pump.

Supplier: Labcon

Labcon's ZAP™ aerosol filter pipette tips have been proven with case studies to block aerosol contamination. Unlike some leading brands of self-sealing aerosol-resistant pipette tips, ZAP™ tips have no cellulose gum, toluene solvent in the filter to mix with and contaminate the sample. ZAP™ tips will not wick fluids like cellulose-filled aerosol-resistant tips.

Supplier: BioVendor

96 wells (1 kit) - ELISA is a sandwich enzyme immunoassay for the quantitative measurement of IGF-2.

Supplier: Cloud-Clone

This assay has high sensitivity and excellent specificity for detecting Rat CLDN5 (Claudin 5). The assay range is from 0.312 to 20 ng/ml (Sandwich kit) with a sensitivity of 0.118 ng/ml. There is no detectable cross to reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.

Supplier: Ansell Healthcare

BioClean™ Nerva™ non-sterile nitrile gloves offer excellent comfort and elbow length protection.

Supplier: Anaspec

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Thermo Scientific Chemicals

MDL: MFCD00149652 Notes: 52-56°C -4H2O, 100°C -5H2O, 120-140°C -6H2O Fieser: 1,155 6,127 10,101 14,99 15,97 18,107 19,104 20,115 21,142

Supplier: Cytiva

Supplements cell culture with amino acids, vitamins, glucose, and trace elements and manufactured to meet cGMP manufacturing standards and QC specifications.