19217 Results for: "AP+physics"

Supplier: G-Biosciences

Sodium Phosphate Dibasic Solution [Na2HPO4] is used to prepare phosphate based biological buffers which are used in molecular biology, biochemistry and chromatography.

Supplier: Thermo Scientific Chemicals

As an analytical reagent, in dye and paint industries, in polymers, in metal treatment, in cleaning and textile finishing, and as a reagent for dehydration and condensation

Supplier: Thermo Scientific Chemicals

Kieselguhr is used in used as a filtration aid, mild abrasive in products including metal polishes and toothpaste, absorbent for liquids, matting agent for coatings, reinforcing filler in plastics and rubber, anti-block in plastic films, porous support for chemical catalysts, cat litter, activator in blood clotting studies, a stabilizing component of dynamite, and a thermal insulator.

Supplier: Thermo Scientific Chemicals

Dichloro[1,1'-bis(diphenylphosphino)ferrocene]palladium(II), Pd 13.5-15.5%. Solid.

Supplier: Wards

A versatile clamp to securely grip a variety of cylindrically shaped glass and labware.

Supplier: Wards

Large, lightweight meters, ideal for classroom demonstrations.

Supplier: WORLD PRECISION INSTRUMENTS LLC

A ball joint attachment Arm for a micromanipulator gives you flexibility and precise positioning options. With a ball joint attachment you can adjust the orientation and angle of the micromanipulator's probe.

Supplier: PerkinElmer

System 2 Electrodeless Discharge Lamps (EDLs) provide the optimized spectral output needed to get the maximum performance from PerkinElmer® Atomic Absorption (AA) spectrometers.

Supplier: Thermo Scientific Chemicals

4',5,7-Trihydroxyisoflavone is used to inhibitor of tyrosine protein kinase. Genistein inhibits EGF-stimulated phosphorylation in cultured cells. Also used to explore signal transduction pathways.

Supplier: Thermo Scientific Chemicals

Liquid

Supplier: Thermo Scientific Chemicals

Powder

Supplier: Thermo Scientific Chemicals

(±)-2-Butanol, anhydrous 99%

Supplier: Thermo Scientific Chemicals

Common Applications: In photography, analytical laboratory as buffer, pharmaceutical

Supplier: Thermo Scientific Chemicals

MDL: MFCD00013140 Beilstein Registry No.: 3919382

Supplier: Thermo Scientific Chemicals

Boron trifluoride diethyl ether complex (≥46,5% BF₃) 46.5% BF₃ min.

Supplier: Thermo Scientific Chemicals

D(+)-Glucose monohydrate 99%

Supplier: Thermo Scientific Chemicals

Bleaching agent for domestic detergents and industrial laundries

Supplier: Thermo Scientific Chemicals

MDL: MFCD00007508 Beilstein: 650741 Soluble in water

Supplier: Thermo Scientific Chemicals

MDL: MFCD00044635 Notes: Minimum isotopic purity 99.96%

Supplier: Thermo Scientific Chemicals

MDL: MFCD00002089 Beilstein Registry No.: 506008 Notes: Same HPLC specifications as 22914 Fieser: 1,296 14,150 15,146 16,149 17,127 18,149 20,154 21,180

Supplier: Thermo Scientific Chemicals

MDL: MFCD00011398 Beilstein Registry No.: 3902818 Solubility in water at 21°C (96g/100ml). Freely soluble in boiling water. Soluble in aqueous HF, liquid NH3. Insoluble in anhydrous alcohol.

Supplier: Thermo Scientific Chemicals

Ceftriaxone sodium hemiheptahydrate, 850-995 microg/mg

Supplier: Thermo Scientific

Use Performance level 1 Thermo Scientific™ SureSTART™ 20 ml glass crimp top vials for everyday chromatography analysis. They provide an affordable choice and can be used with all headspace GC instrument types.

Supplier: Thermo Fisher Scientific

A full-service, automated capping and decapping solution for Thermo Scientific™ Matrix™ and Nunc™ 48 and 96 tube racks.

Supplier: Thermo Scientific Chemicals

MDL: MFCD00011169 Soluble in water with turbidity, precipitating a brown basic salt. Completely soluble in dilute HNO3

Supplier: Thermo Scientific

Choose Thermo Scientific™ SureSTART™ 2 ml glass snap vials, performance level 2, to ensure high quality data with an uninterrupted workflow in high-throughput applications using GC, HPLC/UHPLC, and single or triple quadrupole MS systems.

Supplier: LAMPIRE BIOLOGICAL LABS, INC.

Products are for Laboratory Use Only.

Supplier: Anaspec

This b-amyloid (1-42) contains the Flemish (D23N) mutation where Asp23 is replaced by Asn.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: PerkinElmer

System 2 electrodeless discharge lamp for the detection of elemental Rubidium (Rb). System 2 Electrodeless Discharge Lamps (EDLs) provide the optimized spectral output needed to get the maximum performance from , PerkinElmer® Atomic Absorption spectrometers.

Supplier: Thermo Scientific Chemicals

Lithium iodide hydrate is used as a reagent for ester cleavage and decarboxylation and C-C bond forming reactions. It is also used as source of nucleophilic iodide, as a mild lewis acid, epoxide opening and as an additive for organometallic-mediated transformations.