151 Results for: "470355-984"

Sort By

Supplied Air Respirator Parts & Accessories, 3M™, 3M Company

Supplier: 3M

An assortment of replacement parts and accessories designed for use on a variety of 3M™ Supplied Air Respirators.

Expand 2 Items

Hettich ROTOFIX 46H Heated Benchtop Centrifuge, Hettich Lab Technology

Supplier: HETTICH INSTRUMENTS

Powerful and flexible benchtop centrifuge for organic and inorganic chemistry, preparatory and analytical chemistry, electroplanting, and petrochemistry

Expand 1 Items

Ammonium sulfate ≥99.999% (trace metals basis)

Supplier: BeanTown Chemical

CAS: 7783-20-2; EC No: 231-984-1; MDL No: MFCD00003391; RTECS: BS4500000 Crystalline; Linear Formula: (NH4)2SO4; MW: 132.14 Melting Point: 280° (decomposes) Density (g/mL): 1.77

Expand 3 Items

Ammonium sulfate ≥99.0% ACS

Supplier: BeanTown Chemical

CAS: 7783-20-2; EC No: 231-984-1; MDL No: MFCD00003391; RTECS: BS4500000 Granular; Linear Formula: (NH4)2SO4; MW: 132.14 Melting Point: 280° (decomposes) Density (g/mL): 1.77

Expand 3 Items

Lutetium ≥99.9% (trace metals basis excluding Ta), rods Ø 6.35 mm

Supplier: BeanTown Chemical

CAS: 7439-94-3; EC No: 231-103-0; MDL No: MFCD00011098 Solid, cast rod, diameter is approximate; Molecular Formula: Lu; MW: 174.97 Melting Point: 1663°; Boiling Point: 3402° Density (g/mL): 9.84

Expand 2 Items

The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).

Expand 1 Items

Vacuum Traps, Threaded with Serrated Hose Connections, Ace Glass

Supplier: Ace Glass

This vacuum trap consists of a glass body with Ace-Thred that accepts an adjustable inner tube secured by nylon bushing 89059-220 and FETFE O-ring 89060-984

Expand 5 Items

Anti-PKN2 Rabbit Polyclonal Antibody

Supplier: Genetex

Rabbit Polyclonal antibody to PKN2 (protein kinase N2)

Expand 1 Items

Lutetium ≥99.9% (trace rare earth metals basis), foil, Thickness 0.1 mm

Supplier: BeanTown Chemical

CAS: 7439-94-3; EC No: 231-103-0; MDL No: MFCD00011098 UN No: UN3178; Haz Class: 4.1; Packing Group: III Solid; Molecular Formula: Lu; MW: 174.97 Melting Point: 1663°; Boiling Point: 3402° Density (g/mL): 9.84

Expand 2 Items

N-Carbethoxy-4-piperidone ≥99%

Supplier: BeanTown Chemical

CAS: 29976-53-2; EC No: 249-984-5; MDL No: MFCD00006188 Liquid; Molecular Formula: C8H13NO3; MW: 171.20 Boiling Point: 95-98°/1 mmHg; Flash point: 87°C (189°F) Density (g/mL): 1.135; Refractive Index: 1.475

Expand 3 Items

Lutetium ≥99.9% (trace rare earth metals basis), pieces, distilled dendritic

Supplier: BeanTown Chemical

CAS: 7439-94-3; EC No: 231-103-0; MDL No: MFCD00011098 UN No: UN3178; Haz Class: 4.1; Packing Group: II Solid; Molecular Formula: Lu; MW: 174.97 Melting Point: 1663°; Boiling Point: 3402° Density (g/mL): 9.84

Expand 2 Items

Lutetium ≥99.9% (trace rare earth metals basis), foil, Thickness 0.127 mm

Supplier: BeanTown Chemical

Expand 2 Items

Ammonium sulfate ≥99.95% (trace metals basis)

Supplier: BeanTown Chemical

CAS: 7783-20-2; EC No: 231-984-1; MDL No: MFCD00003391; RTECS: BS4500000 Crystalline; Linear Formula: (NH4)2SO4; MW: 132.14 Melting Point: 280° (decomposes) Density (g/mL): 1.77

Expand 3 Items

Mouse Recombinant VEGFR2/Flk-1/CD309/KDR Protein (Fc Tag) (from HEK293 Cells)

Supplier: Sino Biological

A DNA sequence encoding the mouse KDR (P35918) (Met1-Glu762) was expressed, fused with the Fc region of human IgG1 at the C-terminus.

Expand 1 Items

Anti-POM121 Rabbit Polyclonal Antibody

Supplier: Proteintech

The POM121 antibody from Proteintech is a rabbit polyclonal antibody to a fusion protein of human POM121. This antibody recognizes human, rat antigen. The POM121 antibody has been validated for the following applications: ELISA, WB, IHC, IF analysis.

Expand 1 Items

1-Dodecanethiol ≥98%

Supplier: BeanTown Chemical

CAS: 112-55-0; EC No: 203-984-1; MDL No: MFCD00004885; RTECS: JR3155000 Liquid; Molecular Formula: C12H26S; MW: 202.40 Boiling Point: 266-283°; Flash point: 120°C (248°F) Density (g/mL): 0.845; Refractive Index: 1.459 Air Sensitive

Expand 2 Items

Human Recombinant Semaphorin 5A/SEMA5A Protein (Fc Tag) (from HEK293 Cells)

Supplier: Sino Biological

A DNA sequence encoding the amino acids (Met 1-Thr 765) of human SEMA5A (NP_003957.2) extracellular domain was fused with Fc region of human IgG1 at the C-terminus.