Order Entry
United States
Orders LinkContactUsLinkComponent
52213 results for Proteins and Peptides

You searched for: Proteins and Peptides

Proteins and Peptides

Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.

Human SDF1 active (prokaryotic) (from E.coli)

Human SDF1 active (prokaryotic) (from E.coli)

Supplier: Cloud-Clone

This is a SDF1 active protein (prokaryotic), Human is sequencing from Pro23~Lys89 with 95 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Expand 1 Items
Loading...

Human CD252 (from CHO cells)

Supplier: Adipogen

Human CD252 (CD134L; OX40 ligand) is a type II membrane protein with homology to TNF which is expressed on activated B cells and activated endothelial cells. CD252 binds to CD134 present on activated T cells, providing a costimulatory signal. Blockade of this interaction in mouse abrogated immunological effects in several models of inflammation and rejection. CD252-muCD8 fusion protein binds to CD134 positive cells in flow cytometry.

Expand 1 Items
Loading...

[Lys(Ac)8]-Histone H4 (1-20)

Supplier: Anaspec

This is a histone 4 peptide acetylated at lysine 8. In some studies, this histone modification is thought to predict prognosis of resected non-small-cell lung cancer. This peptide has also been shown to play a role in somatic hypermutation (SHM) possible owing to its modification that likely mediates recruitment of error-prone DNA polymerases at the DNA repair stage of SHM.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human;Rat Biotin-Corticotropin Releasing Factor, Biotin-CRF,Biotin

Supplier: Anaspec

The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4984.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Caloxin 2A1

Supplier: Anaspec

Caloxins are extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 2A1 is a PM Ca2+ pump inhibitor selectively binding to an extracellular domain. It inhibits Ca2+-Mg2+-ATPase in human erythrocyte leaky ghosts. Caloxin 2A1 is active at an extracellular site, the peptide can simply be added exogenously to inhibit the plasma membrane calcium ATPase (PMCA). Related peptides: Caloxin 1A1 (cat# 62605) and Caloxin 3A1 (cat# 62606).
Sequence:VSNSNWPSFPSSGGG
MW:1479.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Beta-Amyloid (1-40) Binding Peptide,Biotin

Supplier: Anaspec

This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not to monomeric beta-Amyloid (1-40). This sequence represents new potential carrier molecules to deliver medicines to amyloid plaques in AD patients and to image plaques in AD brains. The ability to directly target reagents to the amyloid form of the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make amyloid plaques less toxic, the delivery of amyloid-destroying molecules to eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation. This sequence is biotinylated on the N-terminus.
Sequence: Biotin-DWGKGGRWRLWPGASGKTEA
Molecular Weight: 2441.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Recombinant GITR (from HEK293 Cells)

Supplier: Adipogen

GITR (Glucocorticoid-induced TNF receptor) is the receptor for TNFSF18. It is involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T cell receptor-mediated cell death. GITR serves as a negative regulator for NK cell activation. It mediates NF-kappaB activation via the TRAF2/NIK pathway.

Expand 2 Items
Loading...

Rabbit CAP-18

Supplier: Anaspec

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Recombinant Neuroligin 1/NLGN1 (from NS0 Cells)

Supplier: R&D Systems

The Recombinant Human Neuroligin 1v2 (-ssB)/NLGN1v2 (-ssB) from R&D Systems is derived from NS0. The Recombinant Human Neuroligin 1v2 (-ssB)/NLGN1v2 (-ssB) has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Human Recombinant TGF-beta RII (from NS0 Cells)

Supplier: R&D Systems

The Recombinant Human TGF-beta RII Isoform 2 Fc Chimera from R&D Systems is derived from NS0. The Recombinant Human TGF-beta RII Isoform 2 Fc Chimera has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Human Recombinant IL-13 R alpha 2 (from CHO cells)

Supplier: R&D Systems

The Recombinant Human IL-13 R alpha 2 Fc Chimera (CHO) from R&D Systems is derived from CHO. The Recombinant Human IL-13 R alpha 2 Fc Chimera (CHO) has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

[Lys(Ac)12]-Histone H4 (1-21)-GGK,Biotin

Supplier: Anaspec

This peptide is histone H4 (1-21), acetylated at lysine 12. The N-terminus contains a C-terminus GG linker followed by a biotinylated lysine. The acetylation of histone H4 plays a crucial role in structural changes that amplifies the binding of transcription factors to their recognition sites within the nucleosomes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Mouse Recombinant Fc H:Rankl (soluble) (from HEK293 Cells)

Supplier: Adipogen

RANKL is an osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T cell proliferation. Important regulator of interactions between T cells and dendritic cells and may play a role in the regulation of the T cell-dependent immune response. RANKL plays an important role in the progression of Breast cancer.

Expand 1 Items
Loading...
Neurofilament Light Polypeptide Human E. coli, 0.025 mg

Neurofilament Light Polypeptide Human E. coli, 0.025 mg

Supplier: BioVendor

Total 551 AA. MW: 62.5 kDa (calculated). UniProtKB acc.no. P07196 (Ser2-Asp543). N-terminal His-tag (9 extra AA). Protein identity confirmed by LC-MS/MS.

Expand 1 Items
Loading...

Human [Gln22]-beta-Amyloid (1-40)

Supplier: Anaspec

Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...
Hepatitis B Virus Protein X Hepatitis B virus (from E. coli)

Hepatitis B Virus Protein X Hepatitis B virus (from E. coli)

Supplier: BioVendor

Hepatitis B virus X protein (HBx) is a 17 kD transcriptional coactivator that plays a significant role in the regulation of genes involved in inflammation and cell survival. It regulates many transcription factors including nuclear factor kappa B (NF-kappaB) and plays a key role in hepatocarcinogenesis. HBx facilitates the binding of cAMP response element binding protein (CREB) to its responsive element. HBx stabilizes the cellular coactivator ASC-2 through direct protein-protein interaction, affecting the regulation of genes actively transcribed in liver cancer cells.

Expand 1 Items
Loading...

PMDM6-F, FAM (Carboxyfluorescein)

Supplier: Anaspec

PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.
Sequence: 5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
MW: 1784.3Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Recombinant RBP4 (from HEK293 Cells)

Supplier: Adipogen

Retinol binding protein 4 (RBP4; RBP) is a 21kDa secreted protein, a member of the lipocalin family and is known as the primary transporter of retinol (vitamin A) to tissues. A recent report revealed RBP4 as an adipokine linking glucose transporter 4 (GLUT4) suppression in adipose tissue to insulin. Elevated human and mouse serum RBP4 levels are associated with insulin resistance and its severity, obesity, and certain components of metabolic syndrome. Furthermore, human serum RBP4 levels are closely related to renal function.

Expand 2 Items
Loading...

Human Recombinant bCTx (from Synthetic), Ovalbumin

Supplier: Cloud-Clone

This is a bCTx conjugated OVA, Human is sequencing from EKA-His(Beta-Asp)-GGR with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Expand 1 Items
Loading...

Human Ang II Peptide

Supplier: Anaspec

The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed by cleavage of Ang I by the angiotensin-converting enzyme (ACE) or chymases. Human heart chymase, a chymotrypsin-like serine proteinase, hydrolyzes the Phe8-His9 bond to yield the octapeptide hormone angiotensin II and His-Leu.
Sequence: DRVYIHPF
MW: 1046.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 2 Items
Loading...

Human Recombinant IL-1 beta/IL-1F2 (from E. coli)

Supplier: Novus Biologicals

IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins.

Expand 2 Items
Loading...
Multiple Species Recombinant E2 (from Synthetic), BSA (Bovine Serum Albumin)

Multiple Species Recombinant E2 (from Synthetic), BSA (Bovine Serum Albumin)

Supplier: Cloud-Clone

This is a E2 conjugated BSA, General species is sequencing from C18H24O2 with 90 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Expand 1 Items
Loading...

Human Cys-LC-LL-37

Supplier: Anaspec

This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

[Cit3]-Histone H4 (1-23)-GGK,Biotin

Supplier: Anaspec

This peptide is histone H4 (1-23) with deimination at Arg3. It contains a C-terminal GGK linker with biotinylation on the side chain of this Lys. Deimination of Arg3 to Cit is carried out by peptidylarginine deiminase (PADI)-4. Although the function of deimination is not clearly known, it has been shown to inhibit Arg methylation and repress nuclear hormone receptor-dependent gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-Cit-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2830.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Adrenomedullin (1-52)

Supplier: Anaspec

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...
Multiple Species Recombinant EPA (from Synthetic), BSA (Bovine Serum Albumin)

Multiple Species Recombinant EPA (from Synthetic), BSA (Bovine Serum Albumin)

Supplier: Cloud-Clone

This is a EPA conjugated BSA, General species is sequencing from C20H30O2 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Expand 1 Items
Loading...

[Arg(Me2s)26]-Histone H3 (15-36)-GGK,Biotin

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine. It is symmetrically dimethylated at arginine 26 with a methyl group added to each nitrogen of the guanidinium group.
Sequence:APRKQLATKAA-R(Me2s)-KSAPATGGVK-GGK(biotin)
MW:2704.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human CD278 (from CHO cells)

Supplier: Adipogen

The inducible costimulator CD278 (ICOS; T cell activation molecule H4) is similar to human CD28 (24% homology) and plays an analogous role in the T cell activation process. Each secondary signal from CD278 results in a discrete cytokine secretion profile displayed by the activated T cell. Both activation processes are effectively down regulated by CD152 (CTLA-4) engagement.

Expand 1 Items
Loading...

Histone H4 (1-21)-Lys, Biotin

Supplier: Anaspec

This sequence is amino acids 1 to 21 fragment of the histone 4, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys.
Sequence:Ac-SGRGKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2602.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Mouse Recombinant FTO (from E. coli)

Supplier: Adipogen

FTO (Fat mass-and obesity-associated gene) is the responsible gene for mouse ‘fused toes’ mutation. An association between FTO genotype and type 2 diabetes has been confirmed. The presence of the FTO rs9939609 A-allele was found to be positively correlated with other symptoms of the metabolic syndrome, including higher fasting insulin, glucose, triglycerides, and lower HDL-cholesterol.

Expand 1 Items
Loading...
Recommended for You