You searched for: Proteins and Peptides

Supplier: Cloud-Clone

This is a IGF1 recombinant protein (prokaryotic), Human is sequencing from Gly49 ~ Ala118 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a CTSG recombinant protein (prokaryotic), Human is sequencing from Ile21~Leu255 with 97 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant Human Cadherin-11 (CAD-11) Fc Chimera from R&D Systems is derived from NS0. The Recombinant Human Cadherin-11 (CAD-11) Fc Chimera has been validated for the following applications: Bioactivity.

Supplier: Cloud-Clone

This is a CFB active protein (prokaryotic), Mouse is sequencing from Val32~Asp157 with 97 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Anaspec

[Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Adipogen

Fluorogenic substrate for measuring the chymotrypsin-like peptidase activity of the 20S proteasome. Fluorogenic substrate for calpain and papain. Peptide substrate for Ti protease from E.coli. Excitation: 360nm. Emission: 460nm. This substrate is useful for inhibitor screening and kinetic analysis.

Supplier: Cloud-Clone

This is a PTX3 recombinant protein (prokaryotic), Mouse is sequencing from Ile183~Ser381 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Adipogen

Human CD95 (APO-1; Fas) is a type I cell surface glycoprotein that is strongly upregulated on activated T cells, B cells, NK cells and thymocytes. CD95 plays an important role in programmed cell death or apoptosis. Apoptosis appears to be a mechanism for regulating the immune response.

Supplier: Cloud-Clone

This is a TNC recombinant protein (prokaryotic), Mouse is sequencing from Cys174~Ser621 with 97 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a AQP4 recombinant protein (prokaryotic), Human is sequencing from Cys178~Gly317 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a CRP recombinant protein (prokaryotic), Human is sequencing from pH e17~Pro224 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant Human Isocitrate Dehydrogenase 1/IDH1 from R&D Systems is derived from E. coli. The Recombinant Human Isocitrate Dehydrogenase 1/IDH1 has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec

HLA A2-restricted epitope from influenza matrix protein (58-66).
Sequence: GILGFVFTL
MW: 966.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Cloud-Clone

This is a GFP recombinant protein (eukaryotic,Yeast), General species is sequencing from Met1~Lys238 with 95 to 100% purity. Liquid with PBS, pH 7.4, containing 20 Glycerine with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant Human Activin RIIB Fc Chimera (NS0-expressed) from R&D Systems is derived from NS0. The Recombinant Human Activin RIIB Fc Chimera (NS0-expressed) has been validated for the following applications: Bioactivity.

Supplier: Cloud-Clone

This is a SLPI recombinant protein (prokaryotic), Mouse is sequencing from Pro20~Met131 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a PRNP recombinant protein (prokaryotic), Human is sequencing from Lys23~Ser230 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Anaspec

This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.
Sequence:HDAPIGYD
MW:886.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Cloud-Clone

This is a DRD2 recombinant protein (prokaryotic), Human is sequencing from Val200~Ile384 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a FOXP3 recombinant protein (prokaryotic), Mouse is sequencing from Tyr190~Glu412 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a SLC30A8 recombinant protein (prokaryotic), Human is sequencing from Thr263~Asp369 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a MMP14 recombinant protein (prokaryotic), Mouse is sequencing from His121~Asn487 with 90 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Anaspec

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Cloud-Clone

This is a CASP3 active protein (prokaryotic), Human is sequencing from Ser29~His277 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Adipogen

FasL, Soluble (human) (rec.) induces apoptosis in a concentration range of <1ng/ml in the presence of 0.1 to 1µg/ml of TNF Ligands Enhancer (Prod. No. AG-35B-0001). (Optimal conditions must be determined individually for each cell line tested)

Supplier: BioVendor

Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.

Supplier: Adipogen

IL-1RI is the receptor for interleukin-1alpha (IL-1A), beta (IL-1B) and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappaB. Signaling involves formation of a ternary complex containing IL1RAP, leading the activation of TOLLIP, MYD88 and IRAK1 or IRAK2.

Supplier: Cloud-Clone

This is a CYFRA21-1 recombinant protein (prokaryotic), Human is sequencing from Asp244~Leu400 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a GPX4 recombinant protein (prokaryotic), Human is sequencing from Gly74~pH e197 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a VEGFA active protein (prokaryotic), Human is sequencing from Pro28~Arg147 with 97 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.