You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Human Recombinant alpha-1-Antitrypsin
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Kallikrein-1
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Sentrin-Specific Protease 7
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant BAMBI/NMA (from NS0 cells)
Supplier: R&D Systems
The Recombinant Human BAMBI/NMA Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human BAMBI/NMA Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human LL-37, scrambled
Supplier: Anaspec
This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Human Recombinant Fc gamma RIIIA/ CD16a (from HEK293 cells)
Supplier: ACRO Biosystems
Human Fc gamma RIIIA / CD16a (F176) Protein, His Tag (SPR & BLI verified), ACROBiosystems
Expand 1 Items
Human Recombinant DLL3 (from HEK293 Cells)
Supplier: Adipogen
DLL3 (Delta-like protein 3; Delta3) inhibits primary neurogenesis. It plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. DLL3 binds and activates Notch-1. Defects in DLL3 are the cause of spondylocostal dysostosis type 1 (SCDO1).
Expand 2 Items
Recombinant Human Nectin-3, Bon Opus Biosciences
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Parathyroid Hormone
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Transferrin R (from HEK293 Cells), Biotin
Supplier: ACRO Biosystems
Biotinylated Human Transferrin R / CD71 Protein, His,Avitag™ (MALS verified), ACROBiosystems
Expand 2 Items
Recombinant Leucine-rich alpha-2-glycoprotein
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant VEGF165 (from HEK293 Cells), Biotin
Supplier: ACRO Biosystems
Biotinylated VEGF165, epitope tag free, ultra sensitivity (primary amine labeling), Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: No epitope tags, migrates as 24KDa, Synonyms: MGC70609, Size: 200ug
Expand 2 Items
Human Recombinant Poliovirus Receptor-Related Protein 1
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Cynomolgus Monkey Recombinant Fc gamma RIIA/ CD32a (from HEK293 cells)
Supplier: ACRO Biosystems
Biotinylated Cynomolgus Fc gamma RIIA / CD32a Protein, His,Avitag™ (SPR & BLI verified), ACROBiosystems
Expand 2 Items
Human Recombinant CD320 antigen
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Lymphotactin
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Tumor necrosis factor ligand superfamily member 18
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
[Lys(Me2)18]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec
This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
MW:2750.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
W Peptide
Supplier: Anaspec
This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Small Ubiquitin-Related Modifier 2
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant IL-6 (from HEK293 Cells)
Supplier: R&D Systems
The Recombinant Human IL-6 (HEK293-expressed) Protein from R&D Systems is derived from HEK293. The Recombinant Human IL-6 (HEK293-expressed) Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant IL-1 Rrp2 (from HEK293), Unconjugated
Supplier: ACRO Biosystems
Human IL-1 Rrp2/IL-1 R6 (C154S, C262S) Protein, His Tag (MALS verified), Source: expressed from HEK293. It contains AA Asp 20 - Arg 335, protein carries a polyhistidine tag at the C-terminus, Synonyms: IL-1 R6, IL-1 Rrp2, IL1RL2, IL-1RL2, IL1Rrp2, IL-1Rrp2, IL1RRP2, IL-36R, Size: 100uG
Expand 2 Items
Human Recombinant M-CSF R (from HEK293), Unconjugated
Supplier: ACRO Biosystems
Human M-CSF R/CSF1R/CD115 Protein, Mouse IgG2a Fc Tag (MALS verified), Source: expressed from HEK293. It contains AA Ile 20 - Glu 512, Predicted N-terminus: Ile 20, protein carries a mouse IgG2a Fc tag at the C-terminus, Synonyms: CSF1R, C-FMS, CD115, CSFR, FIM2, FMS, M-CSFR, Size: 100uG
Expand 2 Items
Human Recombinant PD-L1 (from HEK293), Unconjugated
Supplier: ACRO Biosystems
Human PD-L1/B7-H1 (19-134) Protein, His Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Phe 19 - Tyr 134, Predicted N-terminus: Phe 19, protein carries a polyhistidine tag at the C-terminus, Synonyms: PD-L1, CD274, B7-H1, PDCD1L1, PDCD1LG1, Size: 100uG
Expand 2 Items
Human Recombinant PLGF (from HEK293), Unconjugated
Supplier: ACRO Biosystems
Human PLGF/PGF (19-221) Protein, Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 19 - Arg 221, Predicted N-terminus: Leu 19, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: PGF, PLGF, PlGF, PGFL, SHGC-10760, Size: 500uG
Expand 2 Items
Threonine Phosphopeptide
Supplier: Anaspec
Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant BLVRA
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant UbcH5c/UBE2D3 (from E. coli)
Supplier: R&D Systems
The Recombinant Human UbcH5c/UBE2D3 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from E. coli. The Recombinant Human UbcH5c/UBE2D3 Protein has been validated for the following applications: Enzyme Activity.
Expand 1 Items
Human Recombinant Apolipoprotein A-IV
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Human Recombinant Beta-Galactosidase
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Janitorial Supplies
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Janitorial Supplies
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International