You searched for: Proteins and Peptides

Supplier: R&D Systems

The Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein from R&D Systems is derived from E. coli. The Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec

This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Stemcell Technologies

Vascular endothelial growth factor D (VEGF-D) is a member of the VEGF/platelet-derived growth factor (PDGF) family of proteins. VEGF-D is a potent angiogenic factor and promotes lymphangiogenesis, endothelial cell growth and survival, and can affect blood vessel permeability. VEGF-D is expressed in the lung, heart, small intestine, fetal lung, and at lower levels in the pancreas, colon, and skeletal muscle (Otrock et al.; Roy et al.; Stacker et al.; Yamada et al.). VEGF-D is a ligand for VEGF receptors 2 (Flk1) and 3 (Flt4) (Baldwin et al.). VEFGR-3 is highly expressed in lymphatic endothelial cells and is essential for their growth and differentiation (Otrock et al.; Roy et al.). Binding of VEGF-D to neuropilins contributes to VEGFR-3 signaling during lymphangiogenesis, whereas binding to integrin α9β1 promotes endothelial cell adhesion and migration (Roy et al.; Otrock et al.). During embryogenesis, VEGF-D also plays a role in the formation of the venous and lymphatic systems.

Supplier: Adipogen

G-CSF is a pleiotropic cytokine best known for its specific effects on the proliferation, differentiation and activation of hematopoietic cells of the neutrophilic granulocyte lineage. It is produced mainly by monocytes and macrophages upon activation by endotoxin, TNF-alpha and IFN-gamma. Other cell types including fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells can also secrete G-CSF after LPS, IL-1 or TNF-alpha activation. In addition, various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF stimulates growth, differentiation and functions of cells from the neutrophil lineage in vitro. Consistent with its in vitro functions, G-CSF has been found to play important roles in defense against infection, in inflammation and repair and in the maintenance of steady state hematopoiesis. Recombinant human G-CSF has been approved for the amelioration of chemotherapy induced neutropenia as well as for severe chronic neutropenia following marrow transplant.

Supplier: Anaspec

This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: BioVendor

Total 462 AA. MW: 51.0 kDa (calculated). UniProtKB acc. No. P01019 (Asp34-Ala485). C-terminal linker (2 extra AA) and C-terminal FLAG-tag (8 extra AA). Protein identity confirmed by LC-MS/MS.

Supplier: Cloud-Clone

This is a Cor conjugated OVA, General species is sequencing from C21H30O5 with 90 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a DHT conjugated BSA, General species is sequencing from C19H30O2 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK from R&D Systems is derived from E. coli. The Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK has been validated for the following applications: Enzyme Activity.

Supplier: Stemcell Technologies

Persephin is a neurotrophic factor that belongs to the glial cell line-derived neurotrophic factor (GDNF) family. Persephin shares a large degree of structural similarity to GDNF, artemin, and neurturin, and has overall neuroprotective activity. Persephin signals through GRFα4 (glycosylphosphatidylinositol (GPI)-linked GDNF receptor family member) which signals through the receptor tyrosine kinase RET. Unlike GDNF and neurturin, persephin only promotes the growth and survival of central dopaminergic and motor neurons, but not peripheral neurons (Milbrandt et al.). in vitro, persephin only promotes survival of neurons that co-express GPI-linked GRFα4 and RET (Enokido et al.; Lindahl et al.). Mice lacking persephin showed increased cell death after cerebral ischemia, however administration of persephin before ischemia dramatically reduced neuronal cell death (Tomac et al.).

Supplier: Adipogen

CD80 (B7-1) and CD86 (B7-2) together with their receptors CD28 and CTLA-4 constitute one of the dominant costimulatory pathways that regulate T cell and B cell responses. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response. B7-1 is expressed on activated B cells, activated T cells and macrophages. B7-2 is constitutively expressed on interdigitating dendritic cells, Langerhans cells, peripheral blood dendritic cells, memory B cells, and germinal center B cells. Additionally, B7-2 is expressed at low levels on monocytes and can be up-regulated through interferon-gamma. B7-1 and B7-2 are both members of the immunoglobulin superfamily. It has been observed that both human and mouse B7-1 and B7-2 can bind to either human or mouse CD28 and CTLA-4, suggesting that there are conserved amino acids which form the B7-1/B7-2/CD28/CTLA-4 critical binding sites.

Supplier: Anaspec

Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Adipogen

TNF-R1 is a receptor for TNF-alpha and homotrimeric lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis.

Supplier: Adipogen

Contactin-6 is a member of the contactins, which mediate cell surface interactions during nervous system development. Contactin-6 has a key role in the formation of glutamatergic, but not GABAergic, synapses during postnatal development of the hippocampal formation as well as the cerebellum. It is involved in oligodendrocytes generation by acting as a ligand of Notch1. It is also involved in motor coordination.

Supplier: BioVendor

Specifications of EndoGrade® ovalbumin:
Source: chicken egg white
Synonyms: Plakalbumin, Allergen Gal d 2, Gal d II
Preparation: Prepared from egg white by ion exchange, crystallization and subjected to pH 4.6 during manufacturing
Purity (SDS-Page): >98%
Contains no salts

Supplier: Anaspec

This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: R&D Systems

The Recombinant Human GST-Ubiquitin E1 Enzyme (UBE1L2/UBA6) from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from Sf 9 (baculovirus). The Recombinant Human GST-Ubiquitin E1 Enzyme (UBE1L2/UBA6) has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec

This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Adipogen

FABP4 is a fatty acid binding protein in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs regulate the fatty acid uptake, transport, and metabolism. aP2, the mouse form of FABP4, seems to be central to the pathway that links obesity to insulin resistance. aP2 was shown to be an adipokine linking adipocytes to hepatic glucose production and that neutralizing secreted aP2 may represent an effective therapeutic strategy against diabetes.

Supplier: Cloud-Clone

This is a MT conjugated BSA, General species is sequencing from C13H16N2O2 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Anaspec

Caerulein, a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary, and pancreatic secretion. Caerulein injections cause acute pancreatitis in mice.
Sequence: Pyr-QD-Y(SO3H)-TGWMDF-NH2
MW: 1352.4 Da
% Peak area by HPLC: 95
Storage condition:

Supplier: Stemcell Technologies

Follistatin, a glycosylated monomeric protein, is a modulator of transforming growth factor beta (TGF-β) superfamily signaling. It binds to and inhibits the function of activin, myostatin, growth differentiation factors, and bone morphogenetic proteins (BMP) (Hansen and Plomgaard). Follistatin inhibits mesoderm induction, suppresses synthesis and secretion of pituitary follicle-stimulating hormone, regulates liver regeneration, and causes infertility (Guo et al.; Iemura et al.). Follistatin exhibits anti-inflammatory effects, and it could be used as a biomarker in cancer (Hansen and Plomgaard).

Supplier: Stemcell Technologies

Interleukin 3 (IL-3) is a species-specific pleiotropic cytokine that promotes the survival and proliferation of pluripotent hematopoietic stem cells and lineage-committed progenitor cells and their differentiation into mature cells of most lineages, including mast cells, basophils, neutrophils, eosinophils, macrophages, dendritic cells, erythrocytes, and megakaryocytes (Fung et al.; Metcalf et al.; Broughton et al.). IL-3 is produced by activated T cells, and has a physiological role in inflammation and allergies by promoting the secretion of inflammatory mediators such as histamine, IL-4, and IL-6 by mast cells, basophils and eosinophils. The mouse IL-3 receptor consists of a unique alpha-subunit (CD123) and two beta subunits, one specific for IL-3 (βIL-3), the other shared with the receptors for IL-5 and GM-CSF (beta common chain, βc or CD131). IL-3 binding to heterodimeric receptors containing the alpha subunit and one of either beta subunits activates JAK/STAT, MAPK, and PI3K signaling pathways (Scott and Begley).

Supplier: Stemcell Technologies

Fibroblast growth factor 7 (FGF-7) is a member of the FGF family, and acts exclusively through a subset of FGF receptor isoforms expressed predominantly by epithelial cells (Finch and Rubin). FGF-7 seems to act specifically on epithelial cells and stimulates proliferation, migration, and differentiation of these cells, and also participates in epithelial protection and repair both in vitro and in vivo (Finch and Rubin; Werner). In contrast, FGF-7 is produced solely by cells of mesenchymal origin, and functions as a paracrine mediator of mesenchymal-epithelial communication (Rubin et al.). FGF-7 has also been shown to supplement several wound-healing properties of bioengineered skin (Erdag et al.) and to induce autophagy in human keratinocytes (Belleudi et al.). Additionally, FGF-7 has a role in pluripotent stem cell differentiation to endodermal pancreatic-like insulin-producing cells and thymic epithelial cells (Inami et al.; Niu et al.).

Supplier: Adipogen

Interleukin-12 (IL-12), also known as Natural Killer Cell Stimulatory Factor (NKSF) or Cytotoxic Lymphocyte Maturation Factor (CLMF), is a heterodimeric pleiotropic cytokine made up of a 40 kDa (p40) subunit and a 35 kDa (p35) subunit. IL-12 is produced by macrophages and B lymphocytes and has been shown to have multiple effects on T cells and Natural Killer (NK) cells. Some of these IL-12 activities include the induction of IFN-gamma and TNF in resting and activated T and NK cells; the enhancement of cytotoxic activity of resting NK and T cells, the stimulation of resting T cell proliferation in the presence of a comitogen; and the enhancement of NK cell proliferation. Current evidence indicates that IL-12 is a key mediator of cellular immunity and induces the differentiation of Th1 cells from precursor T helper cells. Based on its activities, it has been suggested that IL-12 may have therapeutic potential as a vaccine adjuvant that promotes cellular immunity and as an antitumor and anti viral agent.

Supplier: Adipogen

CD127 (IL-7Ra) is the specific receptor component for the cytokine interleukin -7 (IL-7). It is found on a wide variety of hematopoietic cell types including B cell precursors and the majority of T cells. Its expression levels are decreased on T cells following activation. CD127 can dimerize with CD132 (IL-2Rgamma) to form a high affinity IL-7 receptor. CD127 engagement is necessary for T cell development in humans.

Supplier: Anaspec

This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Adipogen

IL-1beta is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta belongs to the IL-1 family of proteins that are involved in the inflammatory response. IL-1beta in most situations requires the inflammasome complex to be cleaved and secreted.