You searched for: Proteins and Peptides

Supplier: ACRO Biosystems

Biotinylated PD-L1/B7-H1 (recommended for biopanning), Avitag*, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: carries an Avitag*at C-terminus, MW of 27.8 kDa, Synonym: PD-L1, Storage: 4-8 deg C, Size: 25ug

Supplier: ACRO Biosystems

Biotinylated TNF-alpha (HPLC-verified), Avitag*, Host: HEK293, Species Reactivity: Mouse, Purity: >95% by SDS-PAGE, Molecular Characterization: carries polyhistidine tag at C-terminus, MW of 20.2 kDa, Synonym: DIF,TNF-alpha,TNFA, Storage: 4-8 deg C, Size: 200ug

Supplier: ACRO Biosystems

Human PD-L1/B7-H1 Protein, Mouse IgG2a Fc, Avitag*, Biotinylated, Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Phe 19, protein carries a mouse IgG2a Fc tag at the C-terminus, followed by an Avi tag, Synonyms: PD-L1, CD274, B7-H1, PDCD1L1, PDCD1LG1, Size: 200uG

Supplier: R&D Systems

The Recombinant Human His6-USP1/His6-UAF1 Complex Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from Sf 21 (baculovirus). The Recombinant Human His6-USP1/His6-UAF1 Complex Protein has been validated for the following applications: Bioactivity.

Supplier: BioVendor

Total 750 AA. MW: 82.4 kDa (calculated). UniProtKB acc.no. P49747. N-Terminal FLAG-tag, 13 extra AA (highlighted). Protein identity confirmed by LC-MS/MS.

Supplier: R&D Systems

The Recombinant Human TGF-beta RI/ALK-5 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human TGF-beta RI/ALK-5 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human Pro-Collagen II Protein from R&D Systems is derived from CHO. The Recombinant Human Pro-Collagen II Protein has been validated for the following applications: Enzyme Activity.

Supplier: ACRO Biosystems

Biotinylated Human PD-1 / PDCD1 Protein, Fc,Avitag™,His Tag (MALS verified), ACROBiosystems

Supplier: ACRO Biosystems

ActiveMax® Human CCL19 / MIP-3 beta Protein, Tag Free, ACROBiosystems

Supplier: Equitech-Bio

With our high purity albumins, researchers can formulate and customize their own specialized media for specific applications.

Supplier: Cloud-Clone

This is a LECT2 recombinant protein (prokaryotic), Mouse is sequencing from Met1~Leu151 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant Human Glycine N-methyltransferase/GNMT from R&D Systems is derived from E. coli. The Recombinant Human Glycine N-methyltransferase/GNMT has been validated for the following applications: Enzyme Activity.

Supplier: Cloud-Clone

This is a GFAP recombinant protein (prokaryotic), Human is sequencing from Met1~Met432 with 90 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a CK18 recombinant protein (prokaryotic), Human is sequencing from Asp238~Leu396 with 95 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a GAL3 recombinant protein (prokaryotic), Mouse is sequencing from Ala2~Ile264 with 97 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: R&D Systems

The Recombinant Human B7-H4 His Tagged Protein from R&D Systems is derived from NS0. The Recombinant Human B7-H4 His Tagged Protein has been validated for the following applications: Bioactivity.

Supplier: ACRO Biosystems

Cynomolgus CD3E&CD3G Heterodimer Protein, Fc Tag&Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Gln 22 (CD3E) & Gln 23 (CD3G), Molecular weight: 40.6 kDa (CD3E) and 40.4 kDa (CD3G), Synonyms: CD3 epsilon & CD3 gamma, CD3E & CD3G, Size: 100uG

Supplier: ACRO Biosystems

Mouse CD3 epsilon&CD3 gamma Heterodimer Protein, His Tag&Flag Tag (MALS verified), Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Asp 23 (CD3E) & Gln 23 (CD3G), Molecular weight: 15.1 kDa (CD3E) and 15.2 kDa (CD3D), Synonyms: CD3 epsilon & CD3 gamma, CD3E & CD3G, Size: 100uG

Supplier: Cloud-Clone

This is a CIRBP active protein (prokaryotic), Human is sequencing from Met1~Glu172 with 95 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a SFTPA1 recombinant protein (prokaryotic), Mouse is sequencing from Asn21~pH e248 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a NUMA1 recombinant protein (prokaryotic), Human is sequencing from Phe1700~His2115 with 95 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a SPD recombinant protein (prokaryotic), Human is sequencing from Ala21~pH e375 with 80 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Cloud-Clone

This is a VDAC1 recombinant protein (prokaryotic), Human is sequencing from Ala2~Ala283 with 90 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: ACRO Biosystems

Cynomolgus Latent TGF-beta 1 (C33S) Protein, His Tag, ACROBiosystems

Supplier: Cloud-Clone

This is a IFNg recombinant protein (prokaryotic), Human is sequencing from Gln24~Gln166 with 95 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.

Supplier: Anaspec

This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C